DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IFT46 and ift46

Sequence 1:NP_609890.2 Gene:IFT46 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_004916113.1 Gene:ift46 XenbaseID:XB-GENE-986153 Length:419 Species:Xenopus tropicalis

Alignment Length:435 Identity:114/436 (26%)
Similarity:173/436 (40%) Gaps:141/436 (32%)


  Fly     4 YDEEITIGGPDSKHLSSVQM-EPRNGGT-----GGGRGGA------------GGGGPGAVGGEGA 50
            |||.:.:.  ||:.::||.. .||..||     |..||.|            ..|.....|..|.
 Frog    62 YDESLEVN--DSEEVASVYTPTPRRPGTAKQMSGKVRGMAELAISSEDEESTKSGKKKKAGKLGD 124

  Fly    51 VRRAAAGRHRRMFQNNSTDD-DGLLQDIIDHDDEAEDSEDDDDSEMQLPQGMTMGVGMTGLVPGP 114
            ||.|   |.:.:..:..|:| :|..:|..|.||:.:|.::|||.:                    
 Frog   125 VRGA---RTQGLTDDEDTEDTEGDDEDDDDDDDDNDDDDEDDDDD-------------------- 166

  Fly   115 NMQKRPGSNRSSKQVPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKR 179
                            ||      ||.......|...|                           
 Frog   167 ----------------DD------EEGHANSNEGYNPA--------------------------- 182

  Fly   180 QDDQSFIMSADKWEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQA 244
                       .:|.|.|..|:||||.||.:||||.::..:.|:||||:|:|||||:||.|||..
 Frog   183 -----------DYEHLPVTAEIKELFQYITRYTPQVVELDYKLKPFIPDFIPAVGDIDAFLKVPR 236

  Fly   245 PPLLQPQRQKDLNDHLEKLGLWLLDEPSGAQSEPSLL------NMKLRSVLSGSMGRNPRHASSA 303
            |           :...:.|||..|||||..||:|:::      |.|..||        .:|....
 Frog   237 P-----------DGKPDNLGLLTLDEPSTRQSDPTVMALWLSENSKQHSV--------TQHIKVK 282

  Fly   304 SLVPTARSGKDIEKWITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYR 365
            ||....|:.|.|:.||..:.::|.::   :::..:|..|||.|:::||..|.:.....:|..|..
 Frog   283 SLENAERNSKAIDAWIESISELHRSKPPATVHYTRPMPDIDTLMQEWPSEFEELLGKVSLPTADI 347

  Fly   366 SCLQQNISVAEYVGVLCERFGVEGPLESQADYIHNVQTLFALYLA 410
            .|     .::.|:.::|....:  |:....  |.::..||:||.|
 Frog   348 DC-----DLSSYIDMICGILDI--PVHKSR--IQSLHVLFSLYSA 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 74/229 (32%)
ift46XP_004916113.1 IFT46_B_C 180..382 CDD:289115 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289286887
eggNOG 1 0.900 E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006294
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.