DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and nutf2l

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001003598.1 Gene:nutf2l / 445204 ZFINID:ZDB-GENE-020416-1 Length:128 Species:Danio rerio

Alignment Length:123 Identity:52/123 - (42%)
Similarity:68/123 - (55%) Gaps:5/123 - (4%)


  Fly     7 YEDIGKEFVQQYYAIFDDPANRENVINFYNATD-SFMTFEGNQIQGAPKILEKVQSLSFQKIARV 70
            :|.||..|||.||..||  .:|..:.:.|  || |.:|:||...||...|:.|:.||.||.|...
Zfish     7 WEQIGSGFVQHYYHQFD--TDRVKLADLY--TDASCLTWEGEGFQGKNAIMTKLNSLPFQTIQHS 67

  Fly    71 ITTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLLKPNGGSLFVAHDIFRLNIHN 128
            ||..|..||.|..|:.:|:|:||.|.|....|.|:||||.........:|:|||.:||
Zfish    68 ITAQDHHPTPDNCVMSMVMGQLKADQDQVMGFQQVFLLKNLDNKWVCTNDMFRLALHN 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 49/118 (42%)
nutf2lNP_001003598.1 NTF2 7..122 CDD:238403 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580760
Domainoid 1 1.000 90 1.000 Domainoid score I7755
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5015
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - mtm6543
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.