DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: APP and Appl

Sequence 1:NP_000475.1 Gene:APP HGNCID:620 Length:770 Species:Homo sapiens
Sequence 2:NP_001245448.1 Gene:Appl FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster

Alignment Length:955 Identity:235/956 (25%)
Similarity:369/956 (39%) Gaps:271/956 (28%)


Human     7 LLLLAAWTARALEVPTDGNAGLLA-----EPQIAMFC--GRLNMHMNV-QNGKWDSDPSGT---K 60
            |||.:.|...|:     |.|.:.|     |||||:.|  |::.....: :.|:|.:|.|..   .
  Fly     9 LLLRSLWVVLAI-----GTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGP 68

Human    61 TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRG---RKQCKTHPHFVIPYRCLVGEF 122
            ||:..|..:|.||::.||...|||:||::....|..||::|   ..:||....::.|:||| |.|
  Fly    69 TCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCL-GPF 132

Human   123 VSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCC 187
            .|||||||:.|.|.|......|...:.|:......|.|:...:..:.|||||||..|.|||||||
  Fly   133 QSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCGISVFSGVEFVCC 197

Human   188 P-------------------------------LAEESDNVD---SADAEEDDSDVWWGGADTDYA 218
            |                               :.:|.|:.|   |.||.|||.|      |.|..
  Fly   198 PKHFKTDEIHVKKTDLPVMPAAQINSANDELVMNDEDDSNDSNYSKDANEDDLD------DEDDL 256

Human   219 DGSEDKVVEVAEEEEV----------------------AEVEE-EEADDDEDDEDGDEVEEEAEE 260
            .|.:::...||:|...                      ||.:. ||.|:.|:|..|.|.|.|.|.
  Fly   257 MGDDEEDDMVADEAATAGGSPNTGSSGDSNSGSLDDINAEYDSGEEGDNYEEDGAGSESEAEVEA 321

Human   261 PYEEA-TERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGC 324
            .:::: ..:..|:.:.:::.:.:......|....::|:......:|         ..|..|....
  Fly   322 SWDQSGGAKVVSLKSDSSSPSSAPVAPAPEKAPVKSESVTSTPQLS---------ASAAAFVAAN 377

Human   325 GGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHA 389
            .||...           |:....|..:.|.:|                     |........||.
  Fly   378 SGNSGT-----------GAGAPPSTAQPTSDP---------------------YFTHFDPHYEHQ 410

Human   390 HFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKA-------VIQHFQEKVESLEQEAA 447
            .::.:::|||..|||::::||::|.:.|.:.:::..||.||       :...||..|::||:|..
  Fly   411 SYKVSQKRLEESHREKVTRVMKDWSDLEEKYQDMRLADPKAAQSFKQRMTARFQTSVQALEEEGN 475

Human   448 NERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHF 512
            .|:.||...|..||.|.:|.|:|.|:..|..||...||...||...|:|.:||..|||.|.|.|:
  Fly   476 AEKHQLAAMHQQRVLAHINQRKREAMTCYTQALTEQPPNAHHVEKCLQKLLRALHKDRAHALAHY 540

Human   513 EH-VRMVDP---KKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEI-------------QD 560
            .| :....|   :.||..|.:.:..|..|...:|||:::|...|.::.:|             :|
  Fly   541 RHLLNSGGPGGLEAAASERPRTLERLIDIDRAVNQSMTMLKRYPELSAKIAQLMNDYILALRSKD 605

Human   561 EV----------------------------------------------------DELLQKEQNYS 573
            ::                                                    :|.|:.|....
  Fly   606 DIPGSSLGMSEEAEAGILDKYRVEIERKVAEKERLRLAEKQRKEQRAAEREKLREEKLRLEAKKV 670

Human   574 DDVLANMISE-----------------------PRISYGNDALM-----PSLTETKTTVELLPVN 610
            ||:|.:.::|                       |....|.||.:     |:|..||:        
  Fly   671 DDMLKSQVAEQQSQPTQSSTQSQAQQQQQEKSLPGKELGPDAALVTAANPNLETTKS-------- 727

Human   611 GEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEF 675
             |..|.|.:    :|..:|....:..:      |..|.....|....:......:.:|.::....
  Fly   728 -EKDLSDTE----YGEATVSTKVQTVL------PTVDDDAVQRAVEDVAAAVAHQEAEPQVQHFM 781

Human   676 RHDSGYEVHHQKLVF-----FAEDVGSNK---GAIIGLMVGGVVIATVIVITLVMLKKKQYTSIH 732
            .||.|    |::..|     ||:...:.|   .....|...|:.:...:.:.:.:.|.:...|.|
  Fly   782 THDLG----HRESSFSLRREFAQHAHAAKEGRNVYFTLSFAGIALMAAVFVGVAVAKWRTSRSPH 842

Human   733 -HGVVEVDAA----------VTPEERHLSKMQQNGYENPTYKFFE 766
             .|.:|||..          :..||:.:..||.|||||||||:||
  Fly   843 AQGFIEVDQVGCQNVTTHHPIVREEKIVPNMQINGYENPTYKYFE 887

Known Domains:


GeneSequenceDomainRegion External IDIdentity
APPNP_000475.1 A4_EXTRA 24..188 CDD:128326 68/178 (38%)
GFLD subdomain. {ECO:0000255|PROSITE-ProRule:PRU01217} 28..123 37/109 (34%)
APP_N 31..131 CDD:280358 43/109 (39%)
Heparin-binding. {ECO:0000269|PubMed:8158260} 96..110 5/17 (29%)
CuBD subdomain. {ECO:0000255|PROSITE-ProRule:PRU01217} 131..189 23/89 (26%)
APP_Cu_bd 133..188 CDD:289676 22/55 (40%)
Zinc-binding 181..188 7/7 (100%)
Kunitz_BPTI 294..342 CDD:278443 6/48 (13%)
APP_E2 366..548 CDD:289677 61/193 (32%)
Heparin-binding 391..423 10/32 (31%)
Heparin-binding 491..522 12/35 (34%)
Collagen-binding. {ECO:0000269|PubMed:8576160} 523..540 5/17 (29%)
Beta-APP 675..713 CDD:281491 10/46 (22%)
Interaction with PSEN1. {ECO:0000269|PubMed:30630874} 695..722 3/30 (10%)
APP_amyloid 716..766 CDD:287486 21/61 (34%)
Basolateral sorting signal 724..734 3/11 (27%)
Interaction with G(o)-alpha 732..751 7/30 (23%)
YENPXY motif, contains endocytosis signal. {ECO:0000269|PubMed:10383380} 757..762 5/5 (100%)
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 66/173 (38%)
APP_N 33..141 CDD:280358 43/109 (39%)
APP_Cu_bd 143..198 CDD:289676 22/55 (40%)
APP_E2 387..580 CDD:289677 64/214 (30%)
GBP_C <629..682 CDD:303769 7/53 (13%)
APP_amyloid 834..887 CDD:287486 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25284163
eggNOG 1 0.900 E1_KOG4295
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3469
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D405630at33208
OrthoFinder 1 1.000 FOG0000838
OrthoInspector 1 1.000 T608780
orthoMCL 1 0.900 OOG5_131699
Panther 1 1.100 O PTHR23103
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2378
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.