DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and CDC7

DIOPT Version :8

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001127891.1 Gene:CDC7 / 8317 HGNCID:1745 Length:574 Species:Homo sapiens

Alignment Length:563 Identity:193/563 - (34%)
Similarity:288/563 - (51%) Gaps:104/563 - (18%)


  Fly   123 SVDKNEEALK---------ELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQRERGLVETQRRRF 178
            |:.|||:..|         :|.|::|:::.:|.:..:||.||||:|.|.|.|.:.|..|    :.
Human    27 SLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEE----KI 87

  Fly   179 AIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFP 243
            |:||..||:||.||..||:|:...||.:||:|:..|.|.||:|...|||:.|:.|.||..||:|.
Human    88 ALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQ 152

  Fly   244 EIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTGKFLLCDFGLAQ---------------- 292
            |:|:|:.||..||:.:|:|.::||||||||.|||||..|:.|.||||||                
Human   153 EVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSE 217

  Fly   293 -----------------RIADDGSVVQSSDLSSREVFSILRDLENGRSVTLTDGNSAQAEAEDYM 340
                             :|...|.|.:..|..|....|:.|...|.: :.:..|...:..:.   
Human   218 AQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQ-IQIKQGKDGKEGSV--- 278

  Fly   341 ARRRMRALGGGGSVERAVTG-------------PPSIQKLRE-QAGGHLTKKDVANQRADTMRLL 391
                      |.||:|:|.|             .|:::.::: :....|::|....::|.:.:::
Human   279 ----------GLSVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVM 333

  Fly   392 NR--LRLVSPNADPN--------NYVVSTNTSKKEMHASRAGTPGYRPPEVLLRYPKQSTAVDVW 446
            |.  :|..:.:...:        :.|.|...|:::..|.||||||:|.||||.:.|.|:||:|:|
Human   334 NSAVMRKTASSCPASLTCDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMW 398

  Fly   447 AAGVIMLSLLSGLHPFFKAPHDCGALAEIINLFGDMPVRKTAFLLDRLILLAQKVNTLDLRRVCM 511
            :||||.||||||.:||:||..|..|||:|:.:.|.....:.|....:.||.:::|...|||::|.
Human   399 SAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCE 463

  Fly   512 RFRHADFF---LAPEIQRKYQRPDGTTEMC---RSC--EQP-------TFNCLCSNS-GHNLERY 560
            |.|..|..   |..:||.........:|..   .||  :.|       :|....||| .|..:.|
Human   464 RLRGMDSSTPKLTSDIQGHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEY 528

  Fly   561 ----DGLDIFPAVAYDLLSRLLEVNPQKRITAEEALKHPFFSD 599
                :|.:..|..|||||.:||::||..||||||||.||||.|
Human   529 NTNLEGWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKD 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 182/530 (34%)
S_TKc 145..597 CDD:214567 182/528 (34%)
PKc_like <238..>363 CDD:304357 48/170 (28%)
PKc_like <364..>462 CDD:304357 36/108 (33%)
PKc_like <427..597 CDD:304357 76/189 (40%)
CDC7NP_001127891.1 STKc_Cdc7 56..438 CDD:270921 137/399 (34%)
PKc_like <293..>419 CDD:328722 41/125 (33%)
PKc_like <358..571 CDD:328722 88/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201173168
eggNOG 1 0.900 E1_KOG1167
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2795
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1361975at2759
OrthoFinder 1 1.000 FOG0003078
OrthoInspector 1 1.000 T1074260
orthoMCL 1 0.900 OOG5_129189
Panther 1 1.100 O PTHR11909
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2064
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.