DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and Cdc7

DIOPT Version :8

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001101822.1 Gene:Cdc7 / 360908 RGDID:1308351 Length:565 Species:Rattus norvegicus

Alignment Length:578 Identity:195/578 - (33%)
Similarity:294/578 - (50%) Gaps:89/578 - (15%)


  Fly    87 LQQAPKCTADLNEKLVKINRQNANKELSTIQAKDMQSVDKNEEALKELQESIPEINKIFDVHCRI 151
            |:...:|.||  :.|.|..:   :.:||.|: :|          ::||.|::|::..:|.:..:|
  Rat    10 LRGCDRCPAD--DSLKKYEQ---SVKLSGIK-RD----------IEELCEAVPQLVSVFKIKDKI 58

  Fly   152 GSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIR 216
            |.||||:|.|.|.|.:.|    :..:.|:||..||:||.||..||:|:...||.:||:|:..|.|
  Rat    59 GEGTFSSVYLATAQLQEG----REEKIALKHLIPTSHPVRIAAELQCLTVAGGQDNVMGVKYCFR 119

  Fly   217 YNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTG 281
            .||:|...|||:.|:.|.||..||:|.|:|:|:.||.:||:.:|:|.::||||||||.|||||..
  Rat   120 KNDHVVIAMPYLEHESFLDILNSLSFQEVREYMFNLFVALKRIHQFGIVHRDVKPSNFLYNRRLK 184

  Fly   282 KFLLCDFGLAQRIADD--------GSVVQSSDLSSREVFSIL-----------RDLENGRSVTLT 327
            |:.|.||||||...|.        .|..|..|.|..:...::           ::::. ...|.|
  Rat   185 KYALVDFGLAQGTRDTKIELLKFVQSEAQQEDCSRNKCHGVIGHKGPLSRPAPKNVDQ-HITTKT 248

  Fly   328 DGNSAQAEAEDYMARRRMRALGGGG-SVERAVTGPPSI------------QKLREQAG--GHLTK 377
            ....:.|.|:.::.:.:....|..| ||:|:|.|..:.            :||.:|:.  ..:::
  Rat   249 SVKRSYANAQIHIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISHESPAEKLIKQSKTVDIMSR 313

  Fly   378 KDVANQRADTMRLLNRLRLVSPNADP---------NNYVVSTNTSKKEMHASRAGTPGYRPPEVL 433
            |....:.|.:.:.:|.....|..:.|         .:.|.|...|:::..|.||||||:|.||||
  Rat   314 KLATKKMAVSTKAVNSSMRDSARSCPAALTCDCYGTDRVCSVCLSRRQQVAPRAGTPGFRAPEVL 378

  Fly   434 LRYPKQSTAVDVWAAGVIMLSLLSGLHPFFKAPHDCGALAEIINLFGDMPVRKTAFLLDRLILLA 498
            .:.|.|:||:|:|:||||.||||||.:||:||..|..|||:|:.:.|.....:.|....:.||.:
  Rat   379 TKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSILCS 443

  Fly   499 QKVNTLDLRRVCMRFRHAD---------------FFLAPEIQRKYQRPDGTTEMCRSCEQPTFNC 548
            ::|...|||.:|.|.|..|               ...|......::.|.......:..|...:. 
  Rat   444 KEVPAQDLRTLCERLRGPDSANPKSAVDPPGNTGHHPAASESTDHKAPHAPASPAQHSEDSLYK- 507

  Fly   549 LCSNSG----HNLERY---DGLDIFPAVAYDLLSRLLEVNPQKRITAEEALKHPFFSD 599
              ..||    |..:|.   :|.|..|..|||||.:||::||..|||||.||.||||.|
  Rat   508 --RGSGGGRRHPRDRTANPEGWDSVPDDAYDLLDKLLDLNPASRITAEAALVHPFFKD 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 178/518 (34%)
S_TKc 145..597 CDD:214567 178/516 (34%)
PKc_like <238..>363 CDD:304357 49/144 (34%)
PKc_like <364..>462 CDD:304357 39/120 (33%)
PKc_like <427..597 CDD:304357 70/191 (37%)
Cdc7NP_001101822.1 STKc_Cdc7 52..461 CDD:270921 149/413 (36%)
PKc_like <372..562 CDD:304357 71/192 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201164857
eggNOG 1 0.900 E1_KOG1167
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2740
OMA 1 1.010
OrthoDB 1 1.010 D1361975at2759
OrthoFinder 1 1.000 FOG0003078
OrthoInspector 1 1.000 T1087902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11909
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.