DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and T05C12.1

DIOPT Version :8

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_495715.1 Gene:T05C12.1 / 188121 WormBaseID:WBGene00011466 Length:325 Species:Caenorhabditis elegans

Alignment Length:219 Identity:56/219 - (25%)
Similarity:102/219 - (46%) Gaps:40/219 - (18%)


  Fly   104 INRQNANKELSTIQAKDMQSVDKNEEALKELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQRER 168
            :|:||.:::.:..|..:::.  ||.....| :|:....|.||.|...|..|.|     |.:.|.|
 Worm     8 VNKQNGHQKQNGAQKSELRG--KNAPPYLE-RETCLGRNDIFVVEKMIAGGGF-----GQVYRAR 64

  Fly   169 GLVETQRRRFAIK-HHNPTNHPERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDR 232
            . .||| ...|:| ....||..:|::.|.:.:      ::::|    .::..||.:|.||.:::.
 Worm    65 N-TETQ-EEVAVKVERATTNDSQRMILESKVL------DDMLG----SKHFPNVYYIGPYHSYNF 117

  Fly   233 FHDIYRSLNFPEIRDYLRN--------------LLIALRHVHKFNVIHRDVKPSNI---LYNRRT 280
            ........|..:||..:.|              ::.||..:|....:|||:||:|.   |..:|.
 Worm   118 IVMQMLGKNIGDIRKMMPNKKISILSSVRIGIQIIEALSLLHSKGWLHRDLKPTNCCLGLDEKRK 182

  Fly   281 GKFLLCDFGLAQRIA-DDGSVVQS 303
            ..:|: |||::::.. |:||:.:|
 Worm   183 TVYLV-DFGMSRKFRNDNGSLRES 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 47/180 (26%)
S_TKc 145..597 CDD:214567 46/178 (26%)
PKc_like <238..>363 CDD:304357 23/84 (27%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
T05C12.1NP_495715.1 PKc_like 46..305 CDD:304357 46/178 (26%)
Pkinase 46..292 CDD:278497 46/178 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.