DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and F39F10.2

DIOPT Version :8

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_510731.1 Gene:F39F10.2 / 185497 WormBaseID:WBGene00018202 Length:298 Species:Caenorhabditis elegans

Alignment Length:150 Identity:32/150 (21%)
Similarity:62/150 (41%) Gaps:16/150 (11%)


  Fly   151 IGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCI 215
            :|.|:|.:|.|...:|...:    |....|:.....:..|...||   .:.:..:.:|.|:....
 Worm    16 LGRGSFGSVQLAQDKRSNEM----RVMKLIRKERDGHRDETWRRE---TFTLTALSDVSGVTKMF 73

  Fly   216 RYNDNVA---FIMPYMTHDRFHDIYRS----LNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSN 273
            .|.....   .:|..::.|....:.|:    .:.|.....:..|:..|:.:|...::|.|:|..|
 Worm    74 EYGSTETHNWIVMEQLSDDLITIVRRNETKMFSKPTSYQIMWQLVKILQDIHAIGIVHTDIKADN 138

  Fly   274 IL--YNRRTGKFLLCDFGLA 291
            ::  |..|..|.:|.|:||:
 Worm   139 LMVSYKNRVRKLVLVDYGLS 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 32/150 (21%)
S_TKc 145..597 CDD:214567 32/150 (21%)
PKc_like <238..>363 CDD:304357 16/60 (27%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
F39F10.2NP_510731.1 PKc_like 9..271 CDD:304357 32/150 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.