DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and Cdc7

DIOPT Version :8

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001258495.1 Gene:Cdc7 / 12545 MGIID:1309511 Length:564 Species:Mus musculus

Alignment Length:577 Identity:189/577 - (32%)
Similarity:280/577 - (48%) Gaps:114/577 - (19%)


  Fly   114 STIQAKDM----QSVDKNEEALK---------ELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQ 165
            |:::..|.    .|:.|.|:::|         ||.|::|::..:|.:..:||.||||:|.|.|.|
Mouse     8 SSLRGSDRCPADDSLKKYEQSVKLSGIKRDIEELCEAVPQLVNVFKIKDKIGEGTFSSVYLATAQ 72

  Fly   166 RERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTH 230
            .:.|    ...:.|:||..||:||.||..||:|:...||.:||:|:..|.|.||:|...|||:.|
Mouse    73 LQEG----HEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEH 133

  Fly   231 DRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTGKFLLCDFGLAQRIA 295
            :.|.||..||:|.|:|:|:.||.:||:.:|:|.::||||||||.|||||..|:.|.||||||...
Mouse   134 ESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTR 198

  Fly   296 DD--------GSVVQSSDLSSREVFSIL-------RDLENGRSVTLTDGNSAQAEAEDYMARR-- 343
            |.        .|..|..|.|..:...::       |..........|...|.:........::  
Mouse   199 DTKIELLKFVQSEAQQEDCSRNKYHGVVGHKGLLSRPAPKTVDQQCTPKTSVKRSYTQVHIKQGK 263

  Fly   344 --RMRALGGGGSVERAVTGPPSI------------QKLREQAG--GHLTKKDVANQRADTMRLLN 392
              :.|::  |.||:|:|.|..:.            :||.:|:.  ..:::|....:.|.:.:.:|
Mouse   264 DGKERSV--GLSVQRSVFGERNFNIHSSISHESPAEKLIKQSKTVDIISRKLATKKTAISTKAMN 326

  Fly   393 RLRLVSPNADP---------NNYVVSTNTSKKEMHASRAGTPGYRPPEVLLRYPKQSTAVDVWAA 448
            .:...:..:.|         ::.|.|...|:::..|.||||||:|.||||.:.|.|:||:|:|:|
Mouse   327 SVMRETARSCPAVLTCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSA 391

  Fly   449 GVIMLSLLSGLHPFFKAPHDCGALAEIINLFGDMPVRKTAFLLDRLILLAQKVNTLDLRRVCMRF 513
            |||.||||||.:||:||..|..|||:|:.:.|.....:.|....:.:|.:::|...|||.:|.|.
Mouse   392 GVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCSKEVPAQDLRALCERL 456

  Fly   514 RHADFFLAPEIQRKYQRPDGTTEMCRSCEQPTFN-----CLCSNSGHNLERY------------- 560
            |..               |.||.  ||...|..|     ....|:.|...|.             
Mouse   457 RGL---------------DSTTP--RSASGPPGNASYDPAASKNTDHKASRVQAAQAQHSEDSLY 504

  Fly   561 ------------------DGLDIFPAVAYDLLSRLLEVNPQKRITAEEALKHPFFSD 599
                              :|.|..|..|||||.:||::||..|||||.||.|.||.|
Mouse   505 KRDNDGYWSHPKDCTSNSEGWDSVPDEAYDLLDKLLDLNPASRITAEAALLHAFFKD 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 176/531 (33%)
S_TKc 145..597 CDD:214567 176/529 (33%)
PKc_like <238..>363 CDD:304357 48/143 (34%)
PKc_like <364..>462 CDD:304357 38/120 (32%)
PKc_like <427..597 CDD:304357 70/205 (34%)
Cdc7NP_001258495.1 STKc_Cdc7 50..429 CDD:270921 137/384 (36%)
PKc_like <337..559 CDD:304357 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201173325
eggNOG 1 0.900 E1_KOG1167
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I2592
Isobase 1 0.950 0 Normalized mean entropy S4005
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003078
OrthoInspector 1 1.000 T1084355
orthoMCL 1 0.900 OOG5_129189
Panther 1 1.100 O PTHR11909
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2064
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.