DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and GLYATL1

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_542392.2 Gene:GLYATL1 HGNCID:30519 Length:333 Species:Homo sapiens

Alignment Length:217 Identity:49/218 (22%)
Similarity:77/218 (35%) Gaps:50/218 (23%)


  Fly    88 KALDLLDWSSGLKCSSIPSRHIGALDSLVE---------------SKKLNLVYRDCTNLFFMKAN 137
            |..::::|...|:..       |..:||.|               |:.|.||..|     .:|.|
Human   121 KNCEIVNWKQRLQIQ-------GLQESLGEGIRVATFSKSVKVEHSRALLLVTED-----ILKLN 173

  Fly   138 DALKLKV---------------EPPSGFVLKSLSVADAPLVNAEWP-NHHEGSLFFVERQIR-LC 185
            .:.|.|:               |.|: |....|.|:.:.|||..|. ..:|.||.:::|.|. |.
Human   174 ASSKSKLGSWAETGHPDDEFESETPN-FKYAQLDVSYSGLVNDNWKRGKNERSLHYIKRCIEDLP 237

  Fly   186 VSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRG-FGSVVTREIAYRLAVQGHDVMALVGP 249
            .:..|..|...  |:|........:|.....:.::|.| ...|:.|.:.| |..:.......|..
Human   238 AACMLGPEGVP--VSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYMKY-LRQKNIPFYISVLE 299

  Fly   250 SNKPSSEMFSKLGFQVIDQCYW 271
            .|:.|.....:.|| ....|.|
Human   300 ENEDSRRFVGQFGF-FEASCEW 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 29/123 (24%)
FR47 187..272 CDD:117022 18/87 (21%)
GLYATL1NP_542392.2 Gly_acyl_tr_N 51..238 CDD:283638 31/130 (24%)
Gly_acyl_tr_C 239..327 CDD:117021 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.