DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and si:ch73-106k19.2

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_009304583.2 Gene:si:ch73-106k19.2 ZFINID:ZDB-GENE-131121-349 Length:284 Species:Danio rerio

Alignment Length:284 Identity:65/285 (23%)
Similarity:118/285 (41%) Gaps:48/285 (17%)


  Fly     7 VIGLKDIQEFQQLYKQNWPKYCQEYYCL---------------DNFVEF--LKKQPHMRNIKMYT 54
            ::..:::::.:.:.|..:|:..:.|.|:               |.:.||  :..:|.::.:|   
Zfish     3 ILTSEELKQAESVLKNFFPESIKVYGCIFNINRGKPHNLEVIADLWPEFTVIICKPKVQGVK--- 64

  Fly    55 LDAKQARDEGLFVIVDRYQLFVGCLN---NTNGLVGK-ALDLLDWSSGLKCSSIPSRHIGALDSL 115
                  ..||.|.|...|......|.   :|.|::.| |..||        :.:..||:||:...
Zfish    65 ------NREGDFNIYSIYSKSKDSLKSFLDTPGVINKDAFTLL--------AGVDIRHLGAVQEF 115

  Fly   116 VESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEW-----PNHHEGSL 175
            .:...:....:...|:..::....|:.| :..:|.....||.|.|.|||:.|     .:.:...|
Zfish   116 ADQHGIPSKVQGVMNVLVLQDQQQLQFK-DRHAGLSFAPLSTAHAHLVNSTWKYGGDSSSYNSVL 179

  Fly   176 FFVERQIRLCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQG 240
            .::.....|||    .:|...|.|:|.:......||.|.....|:.:|:..::...::..|..||
Zfish   180 NYISHNPSLCV----IEEGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNLLEQG 240

  Fly   241 HDVMALVGPSNKPSSEMFSKLGFQ 264
            |.|...|...||||.::|:.||||
Zfish   241 HPVYCFVEEENKPSYKLFTSLGFQ 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 19/97 (20%)
FR47 187..272 CDD:117022 24/79 (30%)
si:ch73-106k19.2XP_009304583.2 Gly_acyl_tr_N 9..187 CDD:310541 38/196 (19%)
NAT_SF 187..264 CDD:327402 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 1 1.000 T597514
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.