DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and si:dkey-76k16.6

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001314704.1 Gene:si:dkey-76k16.6 ZFINID:ZDB-GENE-090312-171 Length:295 Species:Danio rerio

Alignment Length:275 Identity:59/276 (21%)
Similarity:107/276 (39%) Gaps:45/276 (16%)


  Fly    11 KDIQEFQQLYKQNWPKYCQEYYCL----------DNFVEFLKKQPHMRNIKM---YTLDAKQARD 62
            :|::..:...|..:|:..|.|..:          |..:..:.:.|..|.:.:   |.......:|
Zfish    28 EDLKNLEVDLKNYFPQSLQAYGSIVLRNRTGQRADPVIVLVDQWPEFRVLLIKPEYREKGDSFKD 92

  Fly    63 EGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKL------ 121
            ..:|...|.|         ...|:.:. |::||...: |.:...:|...::.:.|::.:      
Zfish    93 MTVFSKNDDY---------LRDLLAQR-DVIDWKKFI-CLAAELKHEKIMEVVAENRGVPVKKEA 146

  Fly   122 ---NLVYRDCTNLFFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIR 183
               .||.:|.:.|   .|.|:|.||:        .||:.:...|||:.|....|.|...::..|.
Zfish   147 VCHMLVLQDLSKL---PAFDSLSLKI--------SSLNESHLELVNSNWKFGCEDSKVMIKNMIA 200

  Fly   184 LCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVG 248
            ...|..:...|.|. |||.:......||.|.....|:.:|:...:...::.:|..||..|.....
Zfish   201 NFPSCCVLDSDDQP-VAWLLTYVSCALGILYTLPEHRGKGYAKALVTVMSKKLHSQGCPVYCFTE 264

  Fly   249 PSNKPSSEMFSKLGF 263
            ..|:.|..:|:.|||
Zfish   265 EENQLSYRLFTSLGF 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 24/101 (24%)
FR47 187..272 CDD:117022 21/78 (27%)
si:dkey-76k16.6NP_001314704.1 Gly_acyl_tr_N 30..204 CDD:283638 37/196 (19%)
NAT_SF 205..283 CDD:302625 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.