DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and CG15155

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609868.1 Gene:CG15155 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster

Alignment Length:279 Identity:101/280 (36%)
Similarity:156/280 (56%) Gaps:28/280 (10%)


  Fly     4 RLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVI 68
            ||:.:|::.:.:.::::.:.|||||:||||||.|:|..||...::::::|.|...:.   |:|||
  Fly     3 RLQQVGVQQLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQVYALPNLEL---GIFVI 64

  Fly    69 VDRYQLFVGCL--NNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNL 131
            ||.||:|||.|  ..:..|..::|.......|.:.:|:|.|:....:.::::|.|.|.. ||..|
  Fly    65 VDHYQIFVGFLEAEQSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQAKNLKLDL-DCVTL 128

  Fly   132 -FFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDT 195
             ..:...:||..:||||:||.||.:.:.||.::|.:|......||..|.||              
  Fly   129 SLVLSKEEALLFQVEPPAGFSLKPVDIDDAQVINDQWEWSEPDSLSVVRRQ-------------- 179

  Fly   196 QELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSK 260
                   |....|.|..||||.|:||||||.::.:|.|.:.|:.|.|.:..|.|.||.|..:|:|
  Fly   180 -------ILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVPENKASLGLFTK 237

  Fly   261 LGFQVIDQCYWLRTEPTGG 279
            |||::.|||:||.|||..|
  Fly   238 LGFKINDQCHWLMTEPPKG 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 29/93 (31%)
FR47 187..272 CDD:117022 33/85 (39%)
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286069
eggNOG 1 0.900 E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.