DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and CG17681

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_724098.2 Gene:CG17681 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster

Alignment Length:287 Identity:106/288 (37%)
Similarity:161/288 (56%) Gaps:9/288 (3%)


  Fly     3 TRL-EVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLF 66
            ||: :|..|||:   |.||.::||..|..|:.|||::.::.:.|.::::..|||| ...|.:|||
  Fly     8 TRITDVANLKDL---QILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLD-NDWRSDGLF 68

  Fly    67 VIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNL 131
            ::|.|||||...|:.....:..||..||||.|.|.|:|...|......|.....||:.....|.:
  Fly    69 ILVHRYQLFFSNLSKQKTDLEVALKQLDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIM 133

  Fly   132 FFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQ 196
            :.:...:|.:|:::.|.|:.|..:.:..|.|:|..|...|.|||..::..|....:||||:::..
  Fly   134 YILNREEAERLQIQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEKELG 198

  Fly   197 ELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQ-GHDVMALVGPSNKPSSEMFSK 260
            .|.|||:|||.|:||||:|..||:|||.|.||...|:..:|.. ..|:.|||..:|..:..:|.|
  Fly   199 SLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITALVNINNSAACRVFEK 263

  Fly   261 LGFQVI--DQCYWLRTEP-TGGQFTWP 284
            |.|::|  :..||...:| .|||.:||
  Fly   264 LNFRLIQDEHYYWSMIKPAAGGQISWP 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 27/92 (29%)
FR47 187..272 CDD:117022 39/88 (44%)
CG17681NP_724098.2 FR47 189..277 CDD:117022 39/88 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286110
eggNOG 1 0.900 E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.