DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and CG15628

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster

Alignment Length:264 Identity:50/265 (19%)
Similarity:108/265 (41%) Gaps:50/265 (19%)


  Fly    48 RNIKMYTLD---------AKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSS 103
            :.||.|..|         ||...|:.:.:      .|.||....:..:.:.|       |:.|.|
  Fly    37 QTIKTYLNDRIWDFKFYVAKDWPDKPIIL------HFPGCTLAPHNNIYQTL-------GIFCPS 88

  Fly   104 IPSRHIGAL---DSLVESKKLNLVYRDCTNLFFMKANDAL----------------------KLK 143
            ....|:..|   |.|::.:|  .:|.:.|::..|...|..                      .|:
  Fly    89 AHIEHVDMLRTEDVLIDWQK--PMYLNFTHIAIMNRLDDFYSKFGVMERLSGDIYVCNKLNADLE 151

  Fly   144 VEP-PSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRLQG 207
            :|| |....::.|::.:...::..:|.:....:...:..:|....:|:::::|.||.||.:....
  Fly   152 LEPLPEDAEMRLLNLDNVQGIHDLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYY 216

  Fly   208 GYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQVIDQCYWL 272
            |.:.::|.:...:|.|:|..:.:.:...:..:|:....::.|.|..|..:::|||::...:...:
  Fly   217 GAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPFVVIRPGNDASRSLYTKLGYEKAFETCRV 281

  Fly   273 RTEP 276
            |..|
  Fly   282 RMTP 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 18/118 (15%)
FR47 187..272 CDD:117022 18/85 (21%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286545
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.