DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and CG15628

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster


Alignment Length:267 Identity:50/267 - (18%)
Similarity:107/267 - (40%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RNIKMYTLD---------AKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSS 103
            :.||.|..|         ||...|:.:.:      .|.||....:..:.:.|       |:.|.|
  Fly    37 QTIKTYLNDRIWDFKFYVAKDWPDKPIIL------HFPGCTLAPHNNIYQTL-------GIFCPS 88

  Fly   104 IPSRHIGAL---DSLVESKKLNLVYRDCTNLFFMKANDAL----------------------KLK 143
            ....|:..|   |.|::.:|  .:|.:.|::..|...|..                      .|:
  Fly    89 AHIEHVDMLRTEDVLIDWQK--PMYLNFTHIAIMNRLDDFYSKFGVMERLSGDIYVCNKLNADLE 151

  Fly   144 VEP-PSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRLQG 207
            :|| |....::.|::.:...::..:|.:....:...:..:|....:|:::::|.||.||.:....
  Fly   152 LEPLPEDAEMRLLNLDNVQGIHDLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYY 216

  Fly   208 GYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQ-------- 264
            |.:.::|.:...:|.|:|..:.:.:...:..:|:....::.|.|..|..:::|||::        
  Fly   217 GAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPFVVIRPGNDASRSLYTKLGYEKAFETCRV 281

  Fly   265 -VIDQCY 270
             :...||
  Fly   282 RMTPDCY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 18/117 (15%)
FR47 187..272 CDD:117022 20/93 (22%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.