DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and Glyat

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat RGDID:1307163 Length:296 Species:Rattus norvegicus

Alignment Length:289 Identity:64/290 (22%)
Similarity:107/290 (37%) Gaps:70/290 (24%)


  Fly     7 VIGLKDIQEFQQLYKQNWPKYCQE-------YYCLD-----NFVEFLKKQPHMRNIKMYTLDAKQ 59
            ::.|:..|..|.|.| :..||..|       .|.::     |....:.|.|....:  .....:|
  Rat     2 IVPLQGAQMLQMLEK-SLKKYLPESLKVYGTIYHVNHGNPFNLKALVDKWPDFNTV--VVRPQEQ 63

  Fly    60 ARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLV 124
            ...:.|....:.||::.....|....:|.: ::::|...|:..|..|....|:.:|.....|.:.
  Rat    64 EMKDDLDFYTNTYQIYSKDPENCQEFLGSS-EVINWKQHLQIQSSQSHLNKAIQNLASIHSLQVK 127

  Fly   125 YRDCTNLFFMKANDALKL--------KVEPPSG---------FVLKSLSVADAPLVNAEWP-NHH 171
            :.:  |:.::.:....||        .:.|.||         |.|.||.|..|.|||..|. ..:
  Rat   128 HSE--NILYVVSETVRKLFPSLLDTKNLSPGSGKPKAINQEMFKLSSLDVTHAALVNKFWLFGGN 190

  Fly   172 EGSLFFVERQIR----LCVSVGLYQEDTQELVAWCI----------------RLQGGYLGALQVK 216
            |.|..|:||.|:    .||   |..|.|.  .:|.:                |.||.....:..:
  Rat   191 ERSQRFIERCIKNFPSSCV---LGPEGTP--ASWTLMDQTGEMRMGGTVPQYRAQGLVSFVIYSQ 250

  Fly   217 D-THKRRGF--------GSVVTREIAYRL 236
            | ..|:|||        .:.|.::::|.|
  Rat   251 DQIMKKRGFPVYSHTDKSNTVMQKMSYSL 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 29/110 (26%)
FR47 187..272 CDD:117022 15/76 (20%)
GlyatNP_001009648.1 Gly_acyl_tr_N 11..206 CDD:283638 45/201 (22%)
Gly_acyl_tr_C 207..295 CDD:117021 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.