DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and Gm4952

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001013784.2 Gene:Gm4952 MGIID:3643569 Length:296 Species:Mus musculus

Alignment Length:249 Identity:54/250 (22%)
Similarity:89/250 (36%) Gaps:54/250 (22%)


  Fly    46 HMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIG 110
            |....::|:.|.|...:            |:|           ..|:::|...|:..|..|....
Mouse    71 HTNTYQIYSKDPKHCLE------------FLG-----------TPDVINWKQHLQIQSSQSNLNE 112

  Fly   111 ALDSLVESKKLNLVYRDCTNLFFMKANDALKL---------KVEPPSG---------FVLKSLSV 157
            |:..|...|.:.:....|  :.:|....|.||         .::..||         |.|.:|.|
Mouse   113 AIMDLAAGKMVKVKRTQC--ILYMMPETAKKLVPSLLEDKEYLDHQSGRPRAIDQEMFKLSTLDV 175

  Fly   158 ADAPLVNAEWP-NHHEGSLFFVERQIRL----CVSVGLYQEDTQELVAWCIRLQGGYLGALQVKD 217
            ..||||:..|. ..:|.|..|:.|.|::    |:   |..|.|.  |:|.:..|.|.:.......
Mouse   176 THAPLVDKFWQFGGNERSQRFIGRCIQIFPSSCL---LGPEGTP--VSWALMDQTGEIRMAGTVP 235

  Fly   218 THKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQVIDQCYW 271
            .::.:|..|.:.......:..:|:.|......:||...:|...| ..|...|.|
Mouse   236 DYRAQGLISHIIYAQTLAMDKRGYPVYNHTEQTNKVIQKMSHTL-HHVPMPCDW 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 29/111 (26%)
FR47 187..272 CDD:117022 18/86 (21%)
Gm4952NP_001013784.2 Gly_acyl_tr_N 10..206 CDD:283638 35/160 (22%)
NAT_SF 207..295 CDD:302625 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.