DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and Gm4952

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001013784.2 Gene:Gm4952 / 240549 MGIID:3643569 Length:296 Species:Mus musculus


Alignment Length:249 Identity:54/249 - (21%)
Similarity:89/249 - (35%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIG 110
            |....::|:.|.|...:            |:|           ..|:::|...|:..|..|....
Mouse    71 HTNTYQIYSKDPKHCLE------------FLG-----------TPDVINWKQHLQIQSSQSNLNE 112

  Fly   111 ALDSLVESKKLNLVYRDCTNLFFMKANDALKL---------KVEPPSG---------FVLKSLSV 157
            |:..|...|.:.:....|  :.:|....|.||         .::..||         |.|.:|.|
Mouse   113 AIMDLAAGKMVKVKRTQC--ILYMMPETAKKLVPSLLEDKEYLDHQSGRPRAIDQEMFKLSTLDV 175

  Fly   158 ADAPLVNAEWP-NHHEGSLFFVERQIRL----CVSVGLYQEDTQELVAWCIRLQGGYLGALQVKD 217
            ..||||:..|. ..:|.|..|:.|.|::    |:   |..|.|.  |:|.:..|.|.:.......
Mouse   176 THAPLVDKFWQFGGNERSQRFIGRCIQIFPSSCL---LGPEGTP--VSWALMDQTGEIRMAGTVP 235

  Fly   218 THKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQVIDQCYW 271
            .::.:|..|.:.......:..:|:.|......:||...:|...| ..|...|.|
Mouse   236 DYRAQGLISHIIYAQTLAMDKRGYPVYNHTEQTNKVIQKMSHTL-HHVPMPCDW 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 28/110 (25%)
FR47 187..272 CDD:117022 18/85 (21%)
Gm4952NP_001013784.2 Gly_acyl_tr_N 10..206 CDD:283638 35/159 (22%)
NAT_SF 207..295 CDD:302625 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.