DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and T10B10.4

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001024902.1 Gene:T10B10.4 / 181613 WormBaseID:WBGene00011681 Length:297 Species:Caenorhabditis elegans


Alignment Length:245 Identity:50/245 - (20%)
Similarity:84/245 - (34%) Gaps:100/245 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SRHIGAL-----------DSLVESKKLNLVYRDCTN--LFFM-KANDALK--LKVEPPSGFVLKS 154
            |||:.|:           ||..||.....||.:.::  :||| |.|:.:|  |.:...||..:..
 Worm    22 SRHVSAIYFPFSIHTQLEDSFPESPVRVFVYPNISHPKMFFMFKDNEFIKPTLALAQVSGTSMNR 86

  Fly   155 LSVADAPLVN----------------------------------AEWPNHH-EGSLFFV-ERQIR 183
            |.:.|  |:|                                  ::|.|:. ..|||:: |.|.:
 Worm    87 LELID--LINEFRTRVFGAKRQPHLVIAEEHLIKMYGVAMRLSSSDWTNNDLRLSLFYMTESQKK 149

  Fly   184 LCVSV-------GLYQEDTQ-----ELV--AW---------------------CIRLQG------ 207
            |.::.       |.|.::.:     |:|  .|                     |:|..|      
 Worm   150 LAMTTPLPNVPHGYYYDEIEPTEEAEIVNNTWKHAGAGDLEQTMAKLLRLPSSCVRFNGKPVAFE 214

  Fly   208 -----GYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNK 252
                 |:.....|.:.|:|:|.|:.|..::.::....|......|...||
 Worm   215 MIDPAGFFNNQYVFEDHRRKGLGNAVEMDLIHKTLSIGFSPFKTVAKDNK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 30/128 (23%)
FR47 187..272 CDD:117022 19/112 (17%)
T10B10.4NP_001024902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.