DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and ZK185.3

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_500585.2 Gene:ZK185.3 WormBaseID:WBGene00022683 Length:293 Species:Caenorhabditis elegans

Alignment Length:292 Identity:60/293 (20%)
Similarity:109/293 (37%) Gaps:68/293 (23%)


  Fly     1 MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEF--LKKQP-HMRNIKMYTLDAKQARD 62
            |..:|.|..|:|:..|...:    ||:.    ...|.|:|  .|:.| |..:...|    :::.:
 Worm     1 MFAKLSVHQLRDLLPFFTSH----PKFA----LFANAVKFEIEKRLPNHPCDFYSY----QKSEE 53

  Fly    63 EGLFVIVDRYQ---------LFVGCLNNT-NGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVE 117
            ...:....|:.         |.:|.:..| ||     .|::.....:|.|.....:|..|.:..|
 Worm    54 NAKYFYCFRHNRLPDSCRPILMIGSVQTTVNG-----DDVICGLEQIKNSEPEFENIILLVASTE 113

  Fly   118 SKKL-NLVYRDCTNL----------FFMKAN---------DALKLKVEPPSGFVLKSLSVADAPL 162
            ..|| |.....|.|:          |::...         |.:.|    |..|.:.|..:.||.:
 Worm   114 LAKLANKYLTTCCNIRENYNVPCNNFYLPITVCPEIQEKVDGITL----PVSFSIGSTRLEDAEI 174

  Fly   163 VNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQ---ELVAWCIRLQGGYLGALQVKDT---HKR 221
            ||:.|.......:...:.:|:...:..::.|:..   |::        |..|.|..:.|   ::.
 Worm   175 VNSTWKFATPEDILQQKEKIQRLPTACIFHEEKPIAFEMI--------GLHGQLSHQYTMPGYRN 231

  Fly   222 RGFGSVVTREIAYRLAVQGHDVMALVGPSNKP 253
            ||||:::...|..:...:|...:..|..||:|
 Worm   232 RGFGAIIENSIVSKCFREGITPVKSVELSNEP 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 23/112 (21%)
FR47 187..272 CDD:117022 16/74 (22%)
ZK185.3NP_500585.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR20958
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.