DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and gip-1

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_497540.3 Gene:gip-1 / 175355 WormBaseID:WBGene00001589 Length:963 Species:Caenorhabditis elegans


Alignment Length:110 Identity:26/110 - (23%)
Similarity:41/110 - (37%) Gaps:32/110 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YYCL------DNFVEFLKKQPHMRNI-------KMYTLDAKQARDEG----LFVIVDRYQLFVGC 78
            |.||      .|.:..||....:||:       .:|.|.|..:.|..    |.||:| |.|.|.|
 Worm   395 YQCLPLIDMWQNRLRLLKMAYKIRNLPQLELLENLYILHAAYSFDSDQKSILDVILD-YTLGVFC 458

  Fly    79 LNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNL 123
                       ..:::|   :....||:.....::...:|.:|.|
 Worm   459 -----------NQMMEW---MTTGEIPTSDKWIIEKNEQSGELFL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 6/33 (18%)
FR47 187..272 CDD:117022
gip-1NP_497540.3 Spc97_Spc98 305..>636 CDD:282045 26/110 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S1135
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.