DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and Glyat

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_666047.1 Gene:Glyat MGIID:2147502 Length:296 Species:Mus musculus

Alignment Length:285 Identity:59/286 (21%)
Similarity:107/286 (37%) Gaps:45/286 (16%)


  Fly     7 VIGLKDIQEFQQLYKQNWPKYCQE--------YYCLD----NFVEFLKKQPHMRNIKMYTLDAKQ 59
            ::.|:..|..|.|.| :..||..|        |:.:.    |....:.|.|....:.:...:.:.
Mouse     2 IVPLQGAQMLQMLEK-SLRKYLPESLKVYGTVYHMIHGNPFNLKALVDKWPDFNTVVVRPQEQEM 65

  Fly    60 ARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLV 124
            ..|  |...::.||::.....|....: ::.::::|...|:..|..|.....:.:|...:...:.
Mouse    66 TDD--LDFYINTYQVYSKDPQNCQEFL-ESSEVINWKQHLQIQSSQSHLNKTIQNLASIQSFQIK 127

  Fly   125 YRDCTNLFFMKANDALKL--------KVEPPSG---------FVLKSLSVADAPLVNAEWP-NHH 171
            :.:  |:.::.:....||        .:...||         |.|.||.|..|.|||..|. ..:
Mouse   128 HSE--NILYVSSETIKKLFPSLLDTKNLSTGSGKPKAIDQDKFKLSSLDVVHAALVNKFWLFGGN 190

  Fly   172 EGSLFFVERQIR----LCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREI 232
            |.|..|:||.|:    .||   |..|.|.  .:|.:..|.|.:........::.:|..|.|....
Mouse   191 ERSQRFIERCIKNFPSSCV---LGPEGTP--ASWTLMDQTGEMRMGGTMPEYRLQGLVSFVVHSQ 250

  Fly   233 AYRLAVQGHDVMALVGPSNKPSSEM 257
            ...:..:|:.|.:....||....:|
Mouse   251 DQIMTKRGYPVYSHTEKSNIAMQKM 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 26/110 (24%)
FR47 187..272 CDD:117022 14/72 (19%)
GlyatNP_666047.1 Gly_acyl_tr_N 11..206 CDD:283638 41/201 (20%)
Gly_acyl_tr_C 207..295 CDD:117021 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9338
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.