DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and GLYAT

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_964011.2 Gene:GLYAT HGNCID:13734 Length:296 Species:Homo sapiens

Alignment Length:258 Identity:62/259 (24%)
Similarity:98/259 (38%) Gaps:56/259 (22%)


  Fly    24 WPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGK 88
            ||.:.....|       .::|....::..||               :.||::.....|....:|.
Human    50 WPDFNTVVVC-------PQEQDMTDDLDHYT---------------NTYQIYSKDPQNCQEFLGS 92

  Fly    89 ALDLLDWSSGLKC-SSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDA-------LKLKVE 145
            . :|::|...|:. ||.||.: .|:.:|...|...:  :....:.:|.|..|       ||.|:.
Human    93 P-ELINWKQHLQIQSSQPSLN-EAIQNLAAIKSFKV--KQTQRILYMAAETAKELTPFLLKSKIL 153

  Fly   146 PPSG----------FVLKSLSVADAPLVNAEWPNH---HEGSLFFVERQIR---LCVSVGLYQED 194
            .|:|          |.|.|:.|..|.|||..|  |   :|.|..|:||.|:   .|..:|  .|.
Human   154 SPNGGKPKAINQEMFKLSSMDVTHAHLVNKFW--HFGGNERSQRFIERCIQTFPTCCLLG--PEG 214

  Fly   195 TQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEM 257
            |.  |.|.:..|.|.:........::..|..:.|....|.:|...|..|.:.|..||:...:|
Human   215 TP--VCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKM 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 34/113 (30%)
FR47 187..272 CDD:117022 17/72 (24%)
GLYATNP_964011.2 Gly_acyl_tr_N 11..206 CDD:310541 44/184 (24%)
Gly_acyl_tr_C 207..295 CDD:117021 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9338
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.