| Sequence 1: | NP_609869.1 | Gene: | CG5783 / 35088 | FlyBaseID: | FBgn0032670 | Length: | 287 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_964011.2 | Gene: | GLYAT / 10249 | HGNCID: | 13734 | Length: | 296 | Species: | Homo sapiens | 
| Alignment Length: | 258 | Identity: | 62/258 - (24%) | 
|---|---|---|---|
| Similarity: | 98/258 - (37%) | Gaps: | 56/258 - (21%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    24 WPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGK 88 
  Fly    89 ALDLLDWSSGLKC-SSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDA-------LKLKVE 145 
  Fly   146 PPSG----------FVLKSLSVADAPLVNAEWPNH---HEGSLFFVERQIR---LCVSVGLYQED 194 
  Fly   195 TQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEM 257 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5783 | NP_609869.1 | Gly_acyl_tr_N | <91..183 | CDD:283638 | 33/112 (29%) | 
| FR47 | 187..272 | CDD:117022 | 17/71 (24%) | ||
| GLYAT | NP_964011.2 | Gly_acyl_tr_N | 11..206 | CDD:310541 | 44/183 (24%) | 
| Gly_acyl_tr_C | 207..295 | CDD:117021 | 18/73 (25%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I5417 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1221333at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R9338 | 
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.000 | |||||