DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and glyatl2

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:glyatl2 / 100490041 XenbaseID:XB-GENE-22068497 Length:282 Species:Xenopus tropicalis


Alignment Length:227 Identity:48/227 - (21%)
Similarity:79/227 - (34%) Gaps:49/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPS------RHIGALDSL-VESKKLNLVY---- 125
            |..|:...|..:.:    |:.::|:...:..|:.:      ||..|..:: .|...|...|    
 Frog    73 YSFFIRDENRIHAV----LEHINWNQAFEIQSMQNYFMNKIRHEAAQRNVDTEISLLRTYYQGTQ 133

  Fly   126 ---------RDCTNLFFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQ 181
                     |...||.|.                   |||.|...||:..|.   .|.....:..
 Frog   134 KETGGEQVQRHQKNLEFC-------------------SLSPAYVSLVDDSWT---FGRCSASQEY 176

  Fly   182 IRLCVS--VGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVM 244
            :.||:.  ......|:...|:|.:....|.:..|......:|:|.||.|...::..:..|...:.
 Frog   177 VSLCIKSHPSCCVLDSGIPVSWVLCDHYGAMRMLYTVPQERRKGLGSKVCSVLSEIMTKQNRPIY 241

  Fly   245 ALVGPSNKPSSEMFSKLGFQVID-QCYWLRTE 275
            ..|...|.||..||..||.|..: :..|:|::
 Frog   242 CHVEEENIPSQLMFKDLGLQETESKLLWVRSK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 20/111 (18%)
FR47 187..272 CDD:117022 20/87 (23%)
glyatl2XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:368708 26/138 (19%)
NAT_SF 187..259 CDD:388411 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.