DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5783 and LOC100490041

Sequence 1:NP_609869.1 Gene:CG5783 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:LOC100490041 ID: Length:282 Species:Xenopus tropicalis

Alignment Length:227 Identity:48/228 (21%)
Similarity:79/228 (35%) Gaps:49/228 (21%)


  Fly    72 YQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPS------RHIGALDSL-VESKKLNLVY---- 125
            |..|:...|..:.:    |:.::|:...:..|:.:      ||..|..:: .|...|...|    
 Frog    73 YSFFIRDENRIHAV----LEHINWNQAFEIQSMQNYFMNKIRHEAAQRNVDTEISLLRTYYQGTQ 133

  Fly   126 ---------RDCTNLFFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQ 181
                     |...||.|.                   |||.|...||:..|.   .|.....:..
 Frog   134 KETGGEQVQRHQKNLEFC-------------------SLSPAYVSLVDDSWT---FGRCSASQEY 176

  Fly   182 IRLCVS--VGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVM 244
            :.||:.  ......|:...|:|.:....|.:..|......:|:|.||.|...::..:..|...:.
 Frog   177 VSLCIKSHPSCCVLDSGIPVSWVLCDHYGAMRMLYTVPQERRKGLGSKVCSVLSEIMTKQNRPIY 241

  Fly   245 ALVGPSNKPSSEMFSKLGFQVID-QCYWLRTE 275
            ..|...|.||..||..||.|..: :..|:|::
 Frog   242 CHVEEENIPSQLMFKDLGLQETESKLLWVRSK 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 20/112 (18%)
FR47 187..272 CDD:117022 21/88 (24%)
LOC100490041XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:283638 26/139 (19%)
NAT_SF 187..259 CDD:302625 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.