| Sequence 1: | NP_609868.1 | Gene: | CG15155 / 35087 | FlyBaseID: | FBgn0032669 | Length: | 258 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001138534.1 | Gene: | Glyatl3 / 688536 | RGDID: | 1587643 | Length: | 290 | Species: | Rattus norvegicus |
| Alignment Length: | 267 | Identity: | 46/267 - (17%) |
|---|---|---|---|
| Similarity: | 88/267 - (32%) | Gaps: | 87/267 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 LELYKKDDQLKDVQVY-ALPNLELG----IFVIVDHYQIFVGFLEAEQSESL------------- 83
Fly 84 -------FKESLLKFKLYGGE---QFASMPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEAL 138
Fly 139 LF---QVEPPAGF------SLKPVDIDDAQVINDQW----------------------------- 165
Fly 166 ---EWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVPE 227
Fly 228 NKASLGL 234 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15155 | NP_609868.1 | NAT_SF | <183..249 | CDD:302625 | 13/52 (25%) |
| Glyatl3 | NP_001138534.1 | Gly_acyl_tr_N | 1..192 | CDD:399190 | 31/185 (17%) |
| NAT_SF | 193..281 | CDD:418431 | 15/80 (19%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CTBC | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1221333at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_108707 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.720 | |||||