DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and Glyatl3

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001138534.1 Gene:Glyatl3 / 688536 RGDID:1587643 Length:290 Species:Rattus norvegicus


Alignment Length:267 Identity:46/267 - (17%)
Similarity:88/267 - (32%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LELYKKDDQLKDVQVY-ALPNLELG----IFVIVDHYQIFVGFLEAEQSESL------------- 83
            ||...|....:.::|| |:.|:..|    ..|::|.:..|...:...|.|::             
  Rat    13 LENMLKSHFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAIITRRQREAVTDNLDHYTNAYAV 77

  Fly    84 -------FKESLLKFKLYGGE---QFASMPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEAL 138
                   :::.|.:..:...:   |...:....:..:..|..||.|.|::.       |:..:|:
  Rat    78 FYKDVRAYQQLLEEHDVINWDQIFQIQGLQSELYTASKAIASAKLLDLEIK-------LASFKAV 135

  Fly   139 LF---QVEPPAGF------SLKPVDIDDAQVINDQW----------------------------- 165
            .|   ..||...|      .|..:.:.||.::|..|                             
  Rat   136 HFSPVSSEPDHSFLTGSTPRLTYLSVTDADLLNRTWSRGGNQQCLRYLAKLIACFPSVCVRDEKG 200

  Fly   166 ---EWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVPE 227
               .|...|..:.:......||           ::|:|:.:|:....||:....|..:...|:.:
  Rat   201 NPVSWGITDQFATMCHGYTLPD-----------HRRKGYSRLVALTLARKLQSRGFPSQGNVLDD 254

  Fly   228 NKASLGL 234
            |.||:.|
  Rat   255 NMASINL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 13/52 (25%)
Glyatl3NP_001138534.1 Gly_acyl_tr_N 1..192 CDD:399190 31/185 (17%)
NAT_SF 193..281 CDD:418431 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CTBC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108707
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.