DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and Glyatl3

DIOPT Version :8

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001138534.1 Gene:Glyatl3 / 688536 RGDID:1587643 Length:290 Species:Rattus norvegicus

Alignment Length:267 Identity:46/268 (17%)
Similarity:88/268 (33%) Gaps:87/268 (32%)


  Fly    37 LELYKKDDQLKDVQVY-ALPNLELG----IFVIVDHYQIFVGFLEAEQSESL------------- 83
            ||...|....:.::|| |:.|:..|    ..|::|.:..|...:...|.|::             
  Rat    13 LENMLKSHFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAIITRRQREAVTDNLDHYTNAYAV 77

  Fly    84 -------FKESLLKFKLYGGE---QFASMPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEAL 138
                   :::.|.:..:...:   |...:....:..:..|..||.|.|::.       |:..:|:
  Rat    78 FYKDVRAYQQLLEEHDVINWDQIFQIQGLQSELYTASKAIASAKLLDLEIK-------LASFKAV 135

  Fly   139 LF---QVEPPAGF------SLKPVDIDDAQVINDQW----------------------------- 165
            .|   ..||...|      .|..:.:.||.::|..|                             
  Rat   136 HFSPVSSEPDHSFLTGSTPRLTYLSVTDADLLNRTWSRGGNQQCLRYLAKLIACFPSVCVRDEKG 200

  Fly   166 ---EWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVPE 227
               .|...|..:.:......||           ::|:|:.:|:....||:....|..:...|:.:
  Rat   201 NPVSWGITDQFATMCHGYTLPD-----------HRRKGYSRLVALTLARKLQSRGFPSQGNVLDD 254

  Fly   228 NKASLGL 234
            |.||:.|
  Rat   255 NMASINL 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 13/53 (25%)
Glyatl3NP_001138534.1 Gly_acyl_tr_N 10..192 CDD:283638 31/186 (17%)
NAT_SF 193..281 CDD:302625 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CTBC
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.