DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and CG12560

DIOPT Version :8

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster

Alignment Length:302 Identity:72/303 (24%)
Similarity:108/303 (36%) Gaps:114/303 (38%)


  Fly    22 EWPK----YC------KEYYCLDTFLELYKKDDQLKDVQVYALPNLELGIFVIVDHYQIFVGFLE 76
            ||.|    |.      :.|.|::.|::..:.|.|||                        |.||.
  Fly    14 EWTKLRDLYVARDTDPQGYPCINNFIKWVEIDPQLK------------------------VNFLS 54

  Fly    77 AE---QSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQAKNLKLD-----LDCV------- 126
            ..   ||:..|..:|        .....|...|||..::       .||     |:|:       
  Fly    55 LNGDWQSDGTFVLTL--------RSDTHMNHIYFNTLSE-------NLDRVTKALECLKSIENEY 104

  Fly   127 ------------------------------TLSLVLSKEEALLFQVEPPAGFSLKPVDIDDAQVI 161
                                          |:....|||....|.::.|.|.||:.:.|:||::|
  Fly   105 DFFGFSTRLKPVVEYIGNKYYANKKLHTVDTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEII 169

  Fly   162 NDQWEWSEPDSLSVVRRQI--------------------LAPDGLLAVLQVKTTYKRRGFGQLIV 206
            |:.|..::|.|:..||..|                    ..|.|.|.:|||..::||.|.|.|:|
  Fly   170 NENWPHNKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLV 234

  Fly   207 KEFARQEALLGRDTITEVVPENKASLGLFTKLGFKINDQCHW 248
            |..|::.:..|...:..||.:|..|..:|.||||:..|..:|
  Fly   235 KSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 26/67 (39%)
CG12560NP_609173.2 FR47 193..277 CDD:117022 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286160
eggNOG 1 0.900 E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.