DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and CG15628

DIOPT Version :8

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster

Alignment Length:299 Identity:59/300 (20%)
Similarity:106/300 (35%) Gaps:89/300 (30%)


  Fly    11 QLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQVYALPN------------------- 56
            :|.::.....|..|:..|.:..:.|:|     :|::.|.:.|...:                   
  Fly    17 ELPEILVTLERYLPESLKFHQTIKTYL-----NDRIWDFKFYVAKDWPDKPIILHFPGCTLAPHN 76

  Fly    57 ---LELGIFVIVDHYQIFVGFLEAEQSESLF---KESLLKF----------KLYGGEQFASMPKR 105
               ..||||....|.: .|..|..|  :.|.   |...|.|          ..|  .:|..|.: 
  Fly    77 NIYQTLGIFCPSAHIE-HVDMLRTE--DVLIDWQKPMYLNFTHIAIMNRLDDFY--SKFGVMER- 135

  Fly   106 YFNVANDIIQAKNLKLDLDCVTLSLVLSKEEALLFQVEP-PAGFSLKPVDIDDAQVINDQWEWSE 169
               ::.||.....|..||                 ::|| |....::.:::|:.|.|:|.:..:|
  Fly   136 ---LSGDIYVCNKLNADL-----------------ELEPLPEDAEMRLLNLDNVQGIHDLYPANE 180

  Fly   170 PD-------------SLSVVRRQ--------ILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQE 213
            .:             .|.:.|::        :.:..|.:..:|.:..::|.|:|..:.|...:..
  Fly   181 IECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLV 245

  Fly   214 ALLGRDTITEVVPENKASLGLFTKLGF-KINDQCHWLMT 251
            ...|......:.|.|.||..|:||||: |..:.|...||
  Fly   246 IERGYTPFVVIRPGNDASRSLYTKLGYEKAFETCRVRMT 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 18/67 (27%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286448
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.