DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15155 and CG14615

Sequence 1:NP_609868.1 Gene:CG15155 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001285525.1 Gene:CG14615 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster

Alignment Length:294 Identity:61/295 (21%)
Similarity:109/295 (37%) Gaps:83/295 (28%)


  Fly    33 LDTFLELYKK------------------DDQLKDVQVYALPNLEL-------------------- 59
            :|..|:|||.                  |.||.:.|:   |..:|                    
  Fly    18 VDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQI---PRNDLNHISLRKQFYTHRRGNFRTW 79

  Fly    60 GIFVIVDHYQIF--VGFLE------AEQSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQA 116
            |.:|.: |..|.  |.|..      ||..|.|.:..|:::.  .|....::...:.|...::..:
  Fly    80 GTYVSL-HRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWT--QGALLTNVDLGFCNRVKELAVS 141

  Fly   117 KNLKLDLDCVTLSLVLSKEEALLFQV-EPPAGFSLKPVDIDDAQVINDQWEWSEPDSLSVVRRQI 180
            :.:..........:|||.|:|...:| :.|:.|.::.:..:||.:::|.|......||:.::..:
  Fly   142 RGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTYLQALV 206

  Fly   181 LAPDGL---------------------LAVLQVKTTYKRRGFGQLIV----KEFARQEALLGRDT 220
            .....|                     |.:|||....:|||.|.|:.    :|.||.|.:    |
  Fly   207 RFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEI----T 267

  Fly   221 ITE-VVPENKASLGLFTKLGFKINDQCHWLMTEP 253
            :|. :|..|..|..|..::|::.:....|:...|
  Fly   268 LTAWIVATNWRSEALLKRIGYQKDLVNEWIKLVP 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 22/92 (24%)
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 29/123 (24%)
FR47 211..297 CDD:117022 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131286422
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20958
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.