DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15155 and T10B10.4

Sequence 1:NP_609868.1 Gene:CG15155 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001024902.1 Gene:T10B10.4 WormBaseID:WBGene00011681 Length:297 Species:Caenorhabditis elegans

Alignment Length:253 Identity:48/254 (19%)
Similarity:79/254 (31%) Gaps:90/254 (35%)


  Fly     9 VQQLGDLKRVFTREWPKYCKEYYCLDTFLEL-YKKDDQLKDVQVYALPNLELGIFVIVDHYQIFV 72
            ::..|...|:.:.:|...       |..|.| |..:.|.|......|||:..|.:     |....
 Worm   117 IKMYGVAMRLSSSDWTNN-------DLRLSLFYMTESQKKLAMTTPLPNVPHGYY-----YDEIE 169

  Fly    73 GFLEAEQSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQ--AKNLKLDLDCVTLSLVLSKE 135
            ...|||...:.:|        :.|             |.|:.|  ||.|:|...||..:     .
 Worm   170 PTEEAEIVNNTWK--------HAG-------------AGDLEQTMAKLLRLPSSCVRFN-----G 208

  Fly   136 EALLFQVEPPAGFSLKPVDIDDAQVINDQWEWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRG 200
            :.:.|::..||||            .|:|:.:.:                          ::|:|
 Worm   209 KPVAFEMIDPAGF------------FNNQYVFED--------------------------HRRKG 235

  Fly   201 FGQLIVKEFARQEALLGRDTITEVVPENKASL--GLFTKLGFKINDQCHWLMTEPPKG 256
            .|..:..:...:...:|......|..:||..|  .:..||         |.|.....|
 Worm   236 LGNAVEMDLIHKTLSIGFSPFKTVAKDNKIVLDASIANKL---------WTMWSDEDG 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 11/68 (16%)
T10B10.4NP_001024902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.