DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and si:ch73-106k19.2

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_009304583.2 Gene:si:ch73-106k19.2 / 799646 ZFINID:ZDB-GENE-131121-349 Length:284 Species:Danio rerio


Alignment Length:153 Identity:36/153 - (23%)
Similarity:68/153 - (44%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 IMYILNREEAERLQIQCPD---GYFLDKVRLEHADLINDLWSARHPG---SLKLIQMLITYNTNV 190
            :|.:|..::.::||.:  |   |.....:...||.|:|..|  ::.|   |...:...|::|.::
Zfish   128 VMNVLVLQDQQQLQFK--DRHAGLSFAPLSTAHAHLVNSTW--KYGGDSSSYNSVLNYISHNPSL 188

  Fly   191 GLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQ--DITALVNIN 253
            .:.|:......:|.|......||.|..||.|:.:|...::.:.:||.:   |:|  .:...|...
Zfish   189 CVIEEGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNL---LEQGHPVYCFVEEE 250

  Fly   254 NSAACRVFEKLNFRLIQDEHYYW 276
            |..:.::|..|.|:...|....|
Zfish   251 NKPSYKLFTSLGFQNSPDYRAVW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 21/90 (23%)
si:ch73-106k19.2XP_009304583.2 Gly_acyl_tr_N 9..187 CDD:310541 15/62 (24%)
NAT_SF 187..264 CDD:327402 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.