DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17681 and si:ch73-106k19.2

Sequence 1:NP_724098.2 Gene:CG17681 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_009304583.2 Gene:si:ch73-106k19.2 ZFINID:ZDB-GENE-131121-349 Length:284 Species:Danio rerio

Alignment Length:153 Identity:36/154 (23%)
Similarity:68/154 (44%) Gaps:15/154 (10%)


  Fly   132 IMYILNREEAERLQIQCPD---GYFLDKVRLEHADLINDLWSARHPG---SLKLIQMLITYNTNV 190
            :|.:|..::.::||.:  |   |.....:...||.|:|..|  ::.|   |...:...|::|.::
Zfish   128 VMNVLVLQDQQQLQFK--DRHAGLSFAPLSTAHAHLVNSTW--KYGGDSSSYNSVLNYISHNPSL 188

  Fly   191 GLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQ--DITALVNIN 253
            .:.|:......:|.|......||.|..||.|:.:|...::.:.:||.:   |:|  .:...|...
Zfish   189 CVIEEGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNL---LEQGHPVYCFVEEE 250

  Fly   254 NSAACRVFEKLNFRLIQDEHYYW 276
            |..:.::|..|.|:...|....|
Zfish   251 NKPSYKLFTSLGFQNSPDYRAVW 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 21/91 (23%)
si:ch73-106k19.2XP_009304583.2 Gly_acyl_tr_N 9..187 CDD:310541 15/63 (24%)
NAT_SF 187..264 CDD:327402 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.