DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17681 and si:dkey-76k16.6

Sequence 1:NP_724098.2 Gene:CG17681 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001314704.1 Gene:si:dkey-76k16.6 ZFINID:ZDB-GENE-090312-171 Length:295 Species:Danio rerio

Alignment Length:244 Identity:50/245 (20%)
Similarity:85/245 (35%) Gaps:44/245 (18%)


  Fly    63 RSDGLFILVHRYQLF---------------------FSNLSKQKTDLEVALKQLDWSRGFKVSAI 106
            |:|.:.:||.::..|                     ||.......||......:||.: |...|.
Zfish    60 RADPVIVLVDQWPEFRVLLIKPEYREKGDSFKDMTVFSKNDDYLRDLLAQRDVIDWKK-FICLAA 123

  Fly   107 HEIHHKIYKQLALDLGLNMDREMNTIMYILNREEAERLQIQCPDGYFLDKVRLEHADLINDLWSA 171
            ...|.||.:.:|.:.|:.:.:|  .:.::|..::..:|.........:..:...|.:|:|..|..
Zfish   124 ELKHEKIMEVVAENRGVPVKKE--AVCHMLVLQDLSKLPAFDSLSLKISSLNESHLELVNSNWKF 186

  Fly   172 RHPGSLKLIQMLITYNTNVGLYEKELGSLC---------AWCLRLQSGFLGALEVLPTHQRRGLG 227
            ....|..:|:.:|.          ...|.|         ||.|...|..||.|..||.|:.:|..
Zfish   187 GCEDSKVMIKNMIA----------NFPSCCVLDSDDQPVAWLLTYVSCALGILYTLPEHRGKGYA 241

  Fly   228 LVVAAAISKAIATDLQQDITALVNINNSAACRVFEKLNFRLIQDEHYYW 276
            ..:...:||.:.:. ...:.......|..:.|:|..|.|....|....|
Zfish   242 KALVTVMSKKLHSQ-GCPVYCFTEEENQLSYRLFTSLGFTEEPDFRAAW 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 22/98 (22%)
si:dkey-76k16.6NP_001314704.1 Gly_acyl_tr_N 30..204 CDD:283638 28/157 (18%)
NAT_SF 205..283 CDD:302625 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.