DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17681 and GLYATL1B

Sequence 1:NP_724098.2 Gene:CG17681 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001342495.1 Gene:GLYATL1B HGNCID:37865 Length:302 Species:Homo sapiens

Alignment Length:290 Identity:47/291 (16%)
Similarity:96/291 (33%) Gaps:93/291 (32%)


  Fly    47 NPTLKHLNFYTLDNDW--------------RSDGLFILVHRYQLFFSNLSKQKTDLEVALKQ--- 94
            ||    .|...|.:.|              .:|.:....:.|::|    ||.....:..||.   
Human    38 NP----FNMEVLVDSWPEYQMVIIRPQKQEMTDDMDSYTNVYRVF----SKDPQKSQEVLKNSEI 94

  Fly    95 LDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTI-----------------MYILNREEA- 141
            ::|.:..::....|         :|..|:......|::                 :|..|:.:. 
Human    95 INWKQKLQIQGFQE---------SLGEGIRAAAFSNSVKVEHSRALLFVTEDILKLYATNKSKLG 150

  Fly   142 ---------ERLQIQCPDGYFLDKVRLEHADLINDLWS-ARHPGSLKLIQMLITYNTNVGLYEKE 196
                     :.|:.:.|: :...::.:.::.|:||.|. ..:..||:.|             ::.
Human   151 SWAETGHPDDELESETPN-FKYAQLNVSYSGLVNDNWKLGMNKRSLRYI-------------KRC 201

  Fly   197 LGSLCAWCLRLQSGF------------LGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITAL 249
            ||:|.|.|:....|.            :|....:..::|||.|..:.....|.:.   |::|...
Human   202 LGALPAACMLGPEGVPVSWVTMDPSCEIGMGYSVEKYRRRGNGTRLIMRCMKYLC---QKNIPFY 263

  Fly   250 VNI--NNSAACRVFEKLNFRLIQDEHYYWS 277
            .::  .|....|....|.|.....:.:.|:
Human   264 GSVLEENQGVIRKTSALGFLEASCQWHQWN 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 19/102 (19%)
GLYATL1BNP_001342495.1 Gly_acyl_tr_N 10..207 CDD:310541 31/200 (16%)
NAT_SF 208..296 CDD:327402 15/90 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221333at2759
OrthoFinder 1 1.000 FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.