DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and SCARB2

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_005497.1 Gene:SCARB2 HGNCID:1665 Length:478 Species:Homo sapiens

Alignment Length:486 Identity:115/487 (24%)
Similarity:214/487 (44%) Gaps:48/487 (10%)


  Fly     5 CCSVRQQKIWVFSMGG------LILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTP 63
            ||         |...|      |:.::.:.:|..:.....|.|...:.|...:..::.|...|.|
Human     4 CC---------FYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLP 59

  Fly    64 VYSTVFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHFLPEK 126
            ||:..:.||.|||.:: ..|..|..|::||||:.:.:.|.::::  |...::....:.:.|..::
Human    60 VYTQFYFFNVTNPEEI-LRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQ 123

  Fly   127 SNGSLD-DVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLL 190
            |.|... |::...:.|.||...:|:  ...||:::...|........:|||..:.|: ||.|.:|
Human   124 SVGDPKIDLIRTLNIPVLTVIEWSQ--VHFLREIIEAMLKAYQQKLFVTHTVDELLW-GYKDEIL 185

  Fly   191 DFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFY-PGE 254
            ..:......:.|.    ||.|||:|.  |.:|::...||.........::.|||:.:..:: ..:
Human   186 SLIHVFRPDISPY----FGLFYEKNG--TNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDK 244

  Fly   255 CGKVNGSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSP 319
            |..:||:.|:.:.|..|.|:...:|..|..|.:.:...:..::.|:..:||:.....:.|   :.
Human   245 CNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILAN---TS 306

  Fly   320 DTECFCLKNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEP 384
            |...||:....|..:|||:........|..||.|||:..|:.:.....|:.|.:.:|..:|.:.|
Human   307 DNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINP 371

  Fly   385 TLGIPL--SLRGQLMISTKVVRD--EAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLKLALNA 445
            ..||.|  :.|.|:.|..|.:.|  |..|: :.:.:    |:..:.....:|:.....||..:|.
Human   372 LTGIILKAAKRFQINIYVKKLDDFVETGDI-RTMVF----PVMYLNESVHIDKETASRLKSMINT 431

  Fly   446 AIIGMYTGIGLVLLGMSIVVTGIFITKKHKW 476
            .:|  .|.|..:::.:     |:|......|
Human   432 TLI--ITNIPYIIMAL-----GVFFGLVFTW 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 109/456 (24%)
SCARB2NP_005497.1 CD36 28..455 CDD:307331 108/452 (24%)
Important for interaction with GBA 155..191 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.