DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and SCARB1

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001354910.1 Gene:SCARB1 HGNCID:1664 Length:552 Species:Homo sapiens

Alignment Length:399 Identity:115/400 (29%)
Similarity:202/400 (51%) Gaps:12/400 (3%)


  Fly     4 GCCSVRQQKIWVFSMGGLILAI-GIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYST 67
            ||.:..:.......:.||:.|: |..:....|::.:|.:...:.:.|:|..:|.|...|.|.|.:
Human     2 GCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLS 66

  Fly    68 VFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEW-NQPQVTYFGKRTWHFLPEKSNGSL 131
            |:.|:..||.:: .:|.||...:.|||.:.:|:.|.::.: |...|::...||:.|.|.||:||.
Human    67 VYFFDVMNPSEI-LKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSE 130

  Fly   132 DDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQL 196
            .|.::.|:...|.||:........|:.:|.......|....|..|.|:.:: ||.|.|::.:.:.
Human   131 SDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMW-GYKDPLVNLINKY 194

  Fly   197 HSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGF-YPGECGKVNG 260
            ...:.|..|. ||.|.|.|||.:  |.||:.||..::|::..:..|||.:...| :..:|..:||
Human   195 FPGMFPFKDK-FGLFAELNNSDS--GLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMING 256

  Fly   261 STGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFC 325
            ::|::|.|:.|.:.....:.|:|.|.:.|..||:...:||..:|:.:......||.:.|..|.||
Human   257 TSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFC 321

  Fly   326 LKNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPL 390
                .|..:|:.:.....|:.|.::|||||...|.:..|..|||.|.:..|.:::.:.|..|||:
Human   322 ----PCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPM 382

  Fly   391 SLRGQLMIS 399
            :...:|.:|
Human   383 NCSVKLQLS 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 112/383 (29%)
SCARB1NP_001354910.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.876977 Normalized mean entropy S6407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.603 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.