DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and CD36

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_000063.2 Gene:CD36 HGNCID:1663 Length:472 Species:Homo sapiens

Alignment Length:468 Identity:111/469 (24%)
Similarity:200/469 (43%) Gaps:46/469 (10%)


  Fly    19 GGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWTNPGDLNTEG 83
            ||:::.:|..|.       ::.|:..:.|...:..:..||.|.|.||...::|:..||.::....
Human    23 GGILMPVGDLLI-------QKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNS 80

  Fly    84 VKPHFEQLGPYTF-----SDFKVKEDLEWNQPQVTYFGKRTWHFLPEKSNGSLDDVVIAPHFPTL 143
            .....:|.||||:     :...|.:|.|.|  .|::.......|.|..|.|:..|     :|..|
Human    81 SNIQVKQRGPYTYRVRFLAKENVTQDAEDN--TVSFLQPNGAIFEPSLSVGTEAD-----NFTVL 138

  Fly   144 TAA------LYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLP 202
            ..|      :|.   .:.::.::|..:|:...:.....|..:.|: ||.|..|..|.      .|
Human   139 NLAVAAASHIYQ---NQFVQMILNSLINKSKSSMFQVRTLRELLW-GYRDPFLSLVP------YP 193

  Fly   203 VYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGECGKVNGSTGELWS 267
            | ..|.|.||..||  ||:|.:.:..|:.::|::..:..:.|:....::...|..:||:....:.
Human   194 V-TTTVGLFYPYNN--TADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFP 255

  Fly   268 PYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLK---NR 329
            |:....|....|..|..|.:....:.::.:.||.|:|:...:....:...:||..|||.:   ::
Human   256 PFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISK 320

  Fly   330 ECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLSLRG 394
            .|...||||........|.|:|.|||........|...||.|.|.||..|:.:||..|..|....
Human   321 NCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAK 385

  Fly   395 QLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLKLALNAAI--IGMYTGIGLV 457
            :|.::..|...|.|.:.||:..::..|:..:.....:.:....:.:..:...|  :|:   |.::
Human   386 RLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGL---IEMI 447

  Fly   458 LLGMSIVVTGIFI 470
            ||.:.:|:...|:
Human   448 LLSVGVVMFVAFM 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 108/464 (23%)
CD36NP_000063.2 CD36 16..461 CDD:307331 111/469 (24%)
Required for interaction with thrombospondins, THBS1 and THBS2. {ECO:0000269|PubMed:1371676} 93..120 5/29 (17%)
Interaction with PTK2, PXN and LYN. {ECO:0000269|PubMed:20037584} 460..472 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.