DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scarb2

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001016557.1 Gene:scarb2 XenbaseID:XB-GENE-948022 Length:483 Species:Xenopus tropicalis

Alignment Length:477 Identity:110/478 (23%)
Similarity:207/478 (43%) Gaps:36/478 (8%)


  Fly    21 LILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWTNPGDLNTEGVK 85
            ||::|.:.|...:..:....::..:.|...|.::..|...|.|||...:.||.|||.:: ..|.|
 Frog    17 LIVSIVLLLTHTFMDIVEGQVKQAIVLKNESEVFEDWANPPPPVYMQFYFFNVTNPLEV-LSGEK 80

  Fly    86 PHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHFLPEKSNGSLD-DVVIAPHFPTLTAAL 147
            |..:::||||:.:::.:|::.:  |..:|:....:|:.|.||||.|... |::...:.|.:| .|
 Frog    81 PFVDEIGPYTYREYRPRENITFSVNGTEVSAVTPKTYVFEPEKSIGDPKVDLIRTVNIPLVT-IL 144

  Fly   148 YSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLPVYDNTFGWFY 212
            ...:...:||..:...|........:|.|..:.|: ||.|.:|..   || |......:|||.||
 Frog   145 EMTKDSSLLRPFIIAALKTYKEGMFVTRTVDELLW-GYKDAVLSI---LH-PFKKNISDTFGLFY 204

  Fly   213 ERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE-CGKVNGSTGELWSPYRTWDQPT 276
            :.|.  |.:|.:...:|..|..:...:..|.|:....::..| |..:||:.|..:.|....|...
 Frog   205 KMNT--TDDGEYIFLSGEKDYLEFTQIAEWKGQKALNWWTTETCNMINGTDGTSFHPLLNKDDTI 267

  Fly   277 TIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLKNRECPRNGVLDYGP 341
            .:|..|..|.:....:.:..|..|.|:|:........|..::|..:.||:....|..:|:|:...
 Frog   268 YMFSSDLCRSIYAVYESSENIKDISVFRFSPPASVFANVSVNPQNKGFCVPEGNCLPSGLLNVSI 332

  Fly   342 PAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLSLRGQLMISTKVVRDE 406
            .....|..:|.|||:..|:....:..|::|.:..|..::.:.|..|..:....::.::. .||..
 Frog   333 CKEGAPIVLSSPHFYQADENVINSIRGMKPVKEHHMTFLDLNPLTGTLIQAAKRIQVNV-YVRKI 396

  Fly   407 AIDLFKNVAYDHYAPLFTMRLHAEL---DEGLTKLLKLALNAAIIGMYTGIGLVLLGMSIVVTGI 468
            .:.|........:.|:  |.|:..:   |:...:|..:.....::   ..|..:::|:.|::..:
 Frog   397 NVYLITQDIQTLFFPV--MHLNESVLIDDKSAGRLRSILFQGRVV---ANIPFIIMGLGIILAFL 456

  Fly   469 FITKKHKWHSEQRPDKHLQCTQ 490
            |.|              |.|.|
 Frog   457 FTT--------------LSCLQ 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 105/455 (23%)
scarb2NP_001016557.1 CD36 29..457 CDD:279474 101/443 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.