DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and cd36

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001002363.1 Gene:cd36 ZFINID:ZDB-GENE-040718-55 Length:465 Species:Danio rerio

Alignment Length:477 Identity:122/478 (26%)
Similarity:204/478 (43%) Gaps:53/478 (11%)


  Fly     5 CCSVRQQKIWVFSMGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVF 69
            ||..|...|....:|.||..:|..|......:.:..:.....|...:..::.|.:....:|...:
Zfish     3 CCDQRCALITGAVLGALIALLGGILIPVGDMIIKNTVHKETVLENGTLAFDTWTSVDIAMYRQFW 67

  Fly    70 LFNWTNPGDLNTEGVKPHFEQLGPYTFS-DFKVKEDLEWNQPQVTYF----GKRTWHFLPEKSNG 129
            :||..||..:.:||.||...|.||||:. .:..|.::.:|......|    |..   |.|..|.|
Zfish    68 IFNVENPDKVLSEGSKPVLVQKGPYTYRVRYIPKTNITFNDNNTVSFVLPAGAT---FEPSMSVG 129

  Fly   130 SLDDVVIAPHFPTL---TAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLD 191
            |.:||     |.:|   .|.:|    |.|..|:.::.:...|.:.....|..:.|: ||.|    
Zfish   130 SEEDV-----FTSLNLAVAGVY----RLIGPKLADWLIRSSGSSLFQNRTVKELLW-GYKD---- 180

  Fly   192 FVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFY-PGEC 255
                      |:.::..|.||..|.  |.:|.:|:.||:.|::::..:..|.||.:..:: ...|
Zfish   181 ----------PMLNSLVGAFYPYNG--TVDGPYTVFTGKDDINKVAIIERWQGETSVNYWNDSYC 233

  Fly   256 GKVNGSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPD 320
            .|:|||.|..:.|:....:|...|.||..|.::...:..:.:.||||:||......:.:...:||
Zfish   234 DKINGSDGSSFHPFLDKKEPLYFFSPDICRSISAEYEATVNLKGIDVYRYLLPVDALASPVSNPD 298

  Fly   321 TECFCLKN---RECPRNGVLDY----GPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGM 378
            ..|:|..:   |.|...|:||.    |.|.|     :|.|||.......::...|:.|...||.:
Zfish   299 NMCYCTDHEITRNCTLAGLLDITSCKGTPVF-----ISLPHFLYASIELQQGVVGMNPNLDEHSI 358

  Fly   379 YVIMEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLKLAL 443
            ::.:||..|..|....:|.::......:.|.|...:......|:..:...|.||:...|:.|..|
Zfish   359 FLDVEPITGFTLRFSKRLQVNMMYGPSDDIALLNKIKEHTIIPILWLNETAVLDDETAKMFKNEL 423

  Fly   444 NAAIIGMYTG--IGLVLLGMSI 463
             .:.:.|..|  |||::.|.:|
Zfish   424 -ISRMDMLEGLQIGLLVTGSAI 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 117/462 (25%)
cd36NP_001002363.1 CD36 17..450 CDD:279474 118/464 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.