DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and Snmp1

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster

Alignment Length:469 Identity:112/470 (24%)
Similarity:197/470 (42%) Gaps:71/470 (15%)


  Fly    21 LILAIGIFLASA----W---PAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWTNPGD 78
            |::..|.....|    |   |.:.:..|...:.|.|.|.:...|..||.|::..:::||.|||.:
  Fly     8 LLMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVFNVTNPDE 72

  Fly    79 LNTEGVKPHFEQLGPYTFSDFKVKEDLEWN--QPQVTYFGKRTWHFLPEKS---NGSLDDVVIAP 138
            : :||.||..:::||:.|.::|.|.|||.:  :..|::..:.|:.|.|::|   .|  ::.:|.|
  Fly    73 V-SEGAKPRLQEVGPFVFDEWKDKYDLEDDVVEDTVSFTMRNTFIFNPKESLPLTG--EEEIILP 134

  Fly   139 H----------------------------FPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTH 175
            |                            ||...|.|.::.:....|.: |...:.|       .
  Fly   135 HPIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLKAKFMDLFFRGI-NVDCSSE-------E 191

  Fly   176 TAGQWLFDGYYDHLLDFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLL 240
            .:.:.|...:|...:...:|::....     .|.:..:.|:|.:  |.||:..|..:..:||.::
  Fly   192 FSAKALCTVFYTGEIKQAKQVNQTHF-----LFSFMGQANHSDS--GRFTVCRGVKNNKKLGKVV 249

  Fly   241 LWNGENTTGFYP-GECGKVNGSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWR 304
            .:..|.....:| |||....|:...:::|....:.....|.||..|.|..:.:...:..|:...|
  Fly   250 KFADEPEQDIWPDGECNTFVGTDSTVFAPGLKKEDGLWAFTPDLCRSLGAYYQHKSSYHGMPSMR 314

  Fly   305 YESTNLTIDNGQLSPDTE--CFCLKNRE---CPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRE 364
            |     |:|.|.:..|.:  |||....:   ||..|.::.. ....||...|.|||:|.|.....
  Fly   315 Y-----TLDLGDIRADEKLHCFCEDPEDLDTCPPKGTMNLA-ACVGGPLMASMPHFYLGDPKLVA 373

  Fly   365 NTTGLQPEESEHGMYVIMEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHA 429
            :..||.|.|.:|.:|:..|...|.|.....:|..:..:...|.|:..||:. ....|:|.:....
  Fly   374 DVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEPMKNLP-KLILPMFWVEEGV 437

  Fly   430 ELDEGLTKLLKLAL 443
            :|::..|.|:|..|
  Fly   438 QLNKTYTNLVKYTL 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 112/470 (24%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 111/466 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52870073
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.