DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and CG3829

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001286874.1 Gene:CG3829 FlyBaseID:FBgn0035091 Length:597 Species:Drosophila melanogaster

Alignment Length:467 Identity:123/468 (26%)
Similarity:221/468 (47%) Gaps:51/468 (11%)


  Fly    45 LPLAPNSFIYNRWVTTPTPVYSTVF---LFNWTNPGD-LNTEGVKPHFEQLGPYTFSDFKVKEDL 105
            |.||.||...|.|: .|.|.|.|:.   :|::.|..| |.....|.....:||.|:.:..||:::
  Fly   118 LILAENSDTANSWL-NPDPKYDTLLKAHIFHYPNIDDYLAGRADKIKVVDVGPLTYQEHTVKDEV 181

  Fly   106 EWNQP-QVTYFGKRTWHFLPEKSNGSLDDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGG 169
            .:|:. .|::..::::.||||||:....:||..|:.|.::||...:|::...|..::..:.:...
  Fly   182 SFNKNFTVSFRDRKSYKFLPEKSSIGEHEVVRVPNVPLISAAGPVKRMKAFERLAVSTWIKQFKE 246

  Fly   170 ATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLS 234
            ......|..::|: ||.|.::    :|.|  |......||....||.  |:..:..|:||..|::
  Fly   247 PLFKNLTVSEYLW-GYEDSII----KLKS--LGRGRRRFGLLMSRNG--TSVDSVQLNTGEDDIT 302

  Fly   235 QLGDLLLWNGENTTGFYPG-ECGKVNGSTGELWSPYRTWDQPT-TIFLPDAARYLNL-FPKENLT 296
            :...:..:||.....::.| ||.:::||...::||:...|:.| .:||....|.:.| |.||...
  Fly   303 KFSIITQFNGMPQLDYWEGDECNRIDGSEPSMFSPHLLQDRSTVNVFLQVLCRKVPLHFEKEVTI 367

  Fly   297 IDGIDVWRYESTNLTIDNGQLSPDTECFCLKNRECPRNGVLD----YGPPAFNGPFYMSHPHFFL 357
            .:.|||.||.:......:...:|..:|:|.....|..:||::    ||    :.|.:.|.||||.
  Fly   368 YNDIDVLRYRTPMDVFSHPSKNPANQCYCQNTELCLPSGVINATKCYG----DAPIFPSFPHFFT 428

  Fly   358 TDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLSLRGQLMIS-----TKVVRDEAIDLFKNVAYD 417
            .|.:..::..|::|:.:.|..|..:.|..|.|:|...::.|:     |.::|::. |..||..  
  Fly   429 GDPVLYQDFEGIEPDAAVHQTYADIHPRFGFPISGASRVQINIMLDKTPILRNQG-DRLKNTT-- 490

  Fly   418 HYAPLFTMRL-HAELDEGLTKLLKLA---LNAAIIGMYTGIGLVLLGM---SIVVTGIFITKKHK 475
             ..||..:.: ..:..|.:...|.|:   |||  |......|.:|:.:   |::|.|::      
  Fly   491 -ILPLMWIEITSGDFSEEVLHTLYLSTFGLNA--IQQTLKYGTLLISVTSFSLIVAGVY------ 546

  Fly   476 WHSEQRPDKHLQ 487
             :...|.::.||
  Fly   547 -YLNSRREQQLQ 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 120/448 (27%)
CG3829NP_001286874.1 CD36 91..546 CDD:279474 120/448 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50693624
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.