DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and CG2736

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster

Alignment Length:482 Identity:110/483 (23%)
Similarity:184/483 (38%) Gaps:98/483 (20%)


  Fly    14 WVFSMGGLILA-IGIFL-ASAWPA-----VSRQWI--RSLLPLAPNSFIYNRWVTTPTPVYSTVF 69
            ||..:..|||| :.:|| ..:|..     |:|:.|  |..:|      ..:.|:.:|...... :
  Fly     6 WVKILLCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMP------TMDSWINSPFGKLKN-Y 63

  Fly    70 LFNWTNPGDLNT-EGVKPHFEQLGPYTFSDFKVKEDLEWNQPQVTY--FGKRTWHFLPEKSNGSL 131
            :||.||..:..: ...:...:::||..:......:.|:.|:..|.|  ...|...||||:|    
  Fly    64 VFNVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEES---- 124

  Fly   132 DDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNRE-----GGATHMTHTAGQWLF--------- 182
                :||                   .|:|:|:...     |.||.:.|||....|         
  Fly   125 ----VAP-------------------DVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALMME 166

  Fly   183 -----DGYYDHLLDFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTG--RGDLSQLGDLL 240
                 |..|..|.:|...|...|..:.:.........|..|..|..:|::.|  || :.....:.
  Fly   167 DIFVTDSVYYFLWEFTRPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRG-IENFFRIE 230

  Fly   241 LWNGE--------NTTGFYPGECG-KVNGS-TGELWSPYRTWDQPTTIFLPDAARYLNLFPKENL 295
            ..|||        :|..:....|. .|:|: ...|:.|:...|.|.:|...::.|.|.|..:...
  Fly   231 TLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQE 295

  Fly   296 TIDGIDVWRYESTNLTIDNGQLSPDTECFCLKNR---ECPRNGVLDYGPPAFN-GPFYMSHPHFF 356
            ..:|:|.:||    ..:.:.|..|.    ||...   :.| :|:.|......| .|...|.|||:
  Fly   296 RYNGLDTFRY----TLLQSHQKPPG----CLDTSYGVKLP-DGMFDVSQCVINDAPSAFSMPHFY 351

  Fly   357 LTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLS--LRGQLMISTKVVR--DEAIDLFKNVAYD 417
            .:...:.::..|..|...:|..|:::||..|||::  .|.|..|....:|  ...:..|.|:...
  Fly   352 GSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIP 416

  Fly   418 HYAPLFTMRLHAELDEGLTKLLKLALN 444
            .:...|.|   .:|...:|.|:.:.:|
  Fly   417 SFWYEFEM---GQLPGFVTSLMWINVN 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 108/476 (23%)
CG2736NP_611991.1 CD36 10..462 CDD:279474 108/479 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50690550
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.