DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and pes

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001137808.1 Gene:pes FlyBaseID:FBgn0031969 Length:555 Species:Drosophila melanogaster

Alignment Length:492 Identity:152/493 (31%)
Similarity:242/493 (49%) Gaps:46/493 (9%)


  Fly    12 KIWVFSMGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWTNP 76
            ::.:..:|...:|.||:|...|..:..:.....:.|:|||..:..|..:|.|:...::|||||||
  Fly    10 RLGIVLLGICCIASGIYLFRNWIDMFTRMRGQEMALSPNSRSFEGWKVSPLPLDFDIYLFNWTNP 74

  Fly    77 GDLNT-EGVKPHFEQLGPYTFSDFKVKEDLEW-NQPQVTYFGKRTW-HFLPEKSNGSLDDVVIAP 138
            .|... ...||||||||||.|.:...|.|:|| |......|.|::| :|....|||||.|.|   
  Fly    75 DDFYVGSNKKPHFEQLGPYRFREKPDKVDIEWHNHNASVSFHKKSWFYFDAAGSNGSLWDKV--- 136

  Fly   139 HFPTLTAALYSRRLRRIL----RKVMNFT--LNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLH 197
              .|:.:..:|...|..:    |..:|..  |.|:|  ..:|.|..:.||.| |:|....|.:|.
  Fly   137 --TTVNSVAHSAARRAAVDWFARTGVNIANKLYRQG--VTITKTVDEMLFKG-YEHPFISVGKLL 196

  Fly   198 SPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGECGKVNGST 262
            .|....| ...|:.|.||.|...:|:..:.||..|::::|.:..||....||.:.|.||:|:||.
  Fly   197 RPQDVPY-KRIGYHYPRNGSSEFDGDINMFTGADDIAKMGQIHTWNNLTHTGAFEGTCGQVHGSM 260

  Fly   263 GELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLK 327
            ||.:.|.........:::|...|.:.|...|.:|:.|:..:::..|...:|||.|.|||.|:|:.
  Fly   261 GEFFPPNLGTKDTVYMYMPKMCRAIPLDYVETVTVHGVTAYKFSGTRHAVDNGTLYPDTRCYCVG 325

  Fly   328 NRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLSL 392
            .: |..:||::.||.:||...|||.|||::.|..|.|...||:||..:|..::.:||..|:|:.:
  Fly   326 GK-CMPSGVINIGPCSFNASVYMSFPHFYMADPSYLEAIEGLRPEREKHEFFMALEPNAGVPMDV 389

  Fly   393 RGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLKLALNAAIIGMYTGIGLV 457
            .|....:..:.....|.|::||. ....|:........:.|      ::|.:.|::.:     :|
  Fly   390 GGGFQANYYMEPIPGITLYENVP-TVMIPMMWCEERVRVSE------EIAADIALVPL-----IV 442

  Fly   458 LLGMSIVVTGIFI-----------TKK--HKWHSEQR 481
            |||.  :||||.:           |::  |..||:.:
  Fly   443 LLGQ--IVTGILLAGGLICTCWYPTRQVTHFCHSDPK 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 147/457 (32%)
pesNP_001137808.1 CD36 14..463 CDD:279474 148/473 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917786
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.