DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scarb2c

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001352071.1 Gene:scarb2c ZFINID:ZDB-GENE-030131-5789 Length:478 Species:Danio rerio

Alignment Length:503 Identity:126/504 (25%)
Similarity:225/504 (45%) Gaps:54/504 (11%)


  Fly     1 MRCGCCSVRQQKIWVFSMGG------LILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVT 59
            ||...|.|        |..|      ||..|.:.|......:....::..:.|...:..::.|..
Zfish     1 MRLRLCCV--------STAGALCVLLLICGIALELTRVLQKLVNNTVKQQIVLENGTEAFSVWQN 57

  Fly    60 TPTPVYSTVFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHF 122
            .|.|||...:.||.|||.:: ..|.||...|:||||:.:::..|::::  |..:|.....:|:.|
Zfish    58 PPPPVYMQFYFFNLTNPAEV-MSGDKPSVVQIGPYTYREYRPMEEVKFMDNGTRVAAINPKTYVF 121

  Fly   123 LPEKSNGSLDDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYD 187
            .|..|.||.||:|...:.|.:|  :..:....||.::::..:..:|.....|...|..|: ||.|
Zfish   122 EPNMSRGSQDDLVRTVNIPAVT--VMEKYKDSILARLISDLMKAKGVGVFETFRVGDLLW-GYED 183

  Fly   188 HLLDFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYP 252
            .||   ::||. |:|  |:.||.||::|.  |...::.|.||:.|......:..|||:.:..::.
Zfish   184 PLL---KELHM-LVP--DDHFGLFYKKNG--TEYDSYVLLTGKPDYQDFASIDEWNGQRSLNWWS 240

  Fly   253 G-ECGKVNGSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQ 316
            . ||..:||:.|..:.|..|......||..|..|.|.:..:.::::.|:..:|:........:..
Zfish   241 SEECNMINGTDGASFHPIITKADRLYIFSSDLCRSLYVQYECDVSVQGVPGFRFVPPADVFSSPD 305

  Fly   317 LSPDTECFCLKNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVI 381
            ::||...||:....|..:|:|:........|..||.|||:..||.:.::..|::|.:.||..:..
Zfish   306 INPDNAGFCVPPGHCLGSGLLNASVCKQGAPIIMSSPHFYQADQKFVDDIWGMKPIKEEHQTFAD 370

  Fly   382 MEPTLGIPLSLRGQLMISTKVVRDEAID---LFKNVAYDHYAPLFTMRLHAELD-EGLTKLLKLA 442
            :.|..||.|....::.::..:.:..:..   ..:.:.:    |:..:...|.:| |...||..:.
Zfish   371 INPLTGIVLQGAKRVQVNVYLQQHSSFSQTGKIQTLVF----PVMYINESAFIDEESAKKLHAVV 431

  Fly   443 LNAAIIGMYTGIGLVLLGMSIVVTGIFITKKHKWHSEQRPDKHLQCTQ 490
            |||.::   ..|..:::.:.|::..|||.              |.|.|
Zfish   432 LNANVV---INIPFIVISVGILLGIIFIV--------------LMCRQ 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 115/455 (25%)
scarb2cNP_001352071.1 CD36 15..457 CDD:307331 117/461 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.