DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and CG40006

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001036401.1 Gene:CG40006 FlyBaseID:FBgn0058006 Length:689 Species:Drosophila melanogaster

Alignment Length:501 Identity:113/502 (23%)
Similarity:195/502 (39%) Gaps:95/502 (19%)


  Fly    21 LILAIGIFLASAWPAVSRQWIRSLLP----------LAPNSFIYNRWVTTPTPVYSTVFLFNWTN 75
            ::|.|| |||    .::...|:.|.|          :.....|:|.|...|..:|..::|||.||
  Fly    93 ILLVIG-FLA----IITSTLIKVLEPYDLIFKWKLIMTEGGEIFNLWAQPPVDLYIKIYLFNITN 152

  Fly    76 PGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWNQPQVTYFGKRTWHFLP-------EKSNGSL-- 131
            .........:...||:|||.:.:....|:       ||:....|....|       |:.:|:.  
  Fly   153 ANAFLAGREQLRVEQVGPYVYKEIMTHEN-------VTFNSNNTMSSTPSHPLVWQEEMSGNCRE 210

  Fly   132 DDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQL 196
            ||.|:..:...|..:..:.....::|..:...|........:..||.:::| ||...|    ..|
  Fly   211 DDEVVMLNIAMLAISHLTANQPFLVRMALKTLLLSTKSEPIVRTTAKEFMF-GYPSAL----ATL 270

  Fly   197 HSPLLP-------------VYD--NTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGEN 246
            .:..||             :||  ..|..||....:....|.:..:.|...|.|      |:|::
  Fly   271 GNTFLPNWISFEKVGLIDRMYDFSTDFETFYTGVPNPALSGLYASYRGETTLPQ------WDGDH 329

  Fly   247 TTGFYPGECGKVN-GSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKEN-LTIDGIDVWRYESTN 309
                    |..:. .|.|..:..:...::....|.....|.:||:...| .|...:..:.|...:
  Fly   330 --------CSNIEFASDGTKFKSFIQPNETVKFFRKSMCRPINLYRVGNEKTYGSLKGYNYVFED 386

  Fly   310 LTIDNGQLSPDTECFCLKNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEES 374
            ...|||..:...:|||.|. :|...|::|.....:..|..:|.|||...|...::|.||:.|:..
  Fly   387 NAFDNGATNEANKCFCRKG-DCQPVGLIDVTDCYYGFPISLSFPHFMNGDVGLQQNVTGISPDPD 450

  Fly   375 EHGMYVIMEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVA-------YDH------YAPLFTMR 426
            :|....:::|..|:||||..::.|:..         ||:::       ::|      :..:...:
  Fly   451 KHSSTFVIQPESGLPLSLSVKVQINMH---------FKDLSNFPVVSVFNHLTVPMLWFEIMMSK 506

  Fly   427 LHAELDEGLTKLLKLALNAAIIGMYTGIGLVLLGMSIVVTGIFITK 472
            |...||......|.:......:|.::||   |||:|::  |..|||
  Fly   507 LPDSLDSRFNFYLNILPLVNPLGFWSGI---LLGISLL--GYAITK 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 110/497 (22%)
CG40006NP_001036401.1 CD36 91..545 CDD:279474 110/498 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50692309
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.876977 Normalized mean entropy S6407
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.