DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and crq

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001245823.1 Gene:crq FlyBaseID:FBgn0015924 Length:491 Species:Drosophila melanogaster

Alignment Length:479 Identity:178/480 (37%)
Similarity:280/480 (58%) Gaps:4/480 (1%)


  Fly     1 MRCGCCSVRQQKIWVFSMGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVY 65
            |.|.||...|:|:|||.:|.:.|.:||.:...||.::...:...|.|.|.:..|..|:..|.|:|
  Fly     1 MCCKCCGETQRKVWVFGLGSVFLLLGILIVVFWPGIADNLVEDGLTLKPGTDAYESWLEAPIPIY 65

  Fly    66 STVFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLE-WNQPQVTYFGKRTWHFLPEKSNG 129
            .:.::||||||.|:....:||:|.::|||||.:...||:.. ::...|.|:.:|||.|.||:|||
  Fly    66 LSFYMFNWTNPEDIRNPDIKPNFVEMGPYTFLEKHKKENYTFYDNATVAYYERRTWFFDPERSNG 130

  Fly   130 SLDDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVE 194
            :|||:|.|.|..|.|.|...|..|:|::|::||.||.|||..::|...|:|:|:||.|::.||:.
  Fly   131 TLDDMVTAAHAITATVADEMRDQRKIVKKIINFMLNHEGGKLYVTKPVGEWIFEGYQDNITDFLN 195

  Fly   195 QLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGECGKVN 259
            ..::..:.:....|||..:||.|.|.:|.||:|||..|:|.||.|..|||::.||||...||.||
  Fly   196 LFNTTKIDIPYKRFGWLADRNESLTYDGLFTIHTGTDDISNLGRLTHWNGKSETGFYEMPCGIVN 260

  Fly   260 GSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECF 324
            |:||:::.|....:...|||..||.|::||.|:......|:...::..|..|:|:|:..|:..||
  Fly   261 GTTGDMFPPKMNVNDEITIFATDACRFMNLRPRGTYENHGLTATKWVGTEETLDSGENYPNQACF 325

  Fly   325 CLKNR--ECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLG 387
            |.:.|  |||:.||::........|.|.|.|||:|.||.|.:..:|::||:.:|..::.:||..|
  Fly   326 CDEARFDECPKTGVVECKACRDKAPIYSSFPHFYLADQSYVDAVSGMKPEKEKHEFFLAVEPITG 390

  Fly   388 IPLSLRGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLKLALNAAIIGMYT 452
            :|:.:.|::.|:..:..|:..|:::.| .....|:|....:|||...|....|||:|.:..|:..
  Fly   391 VPVQVHGRIQINMMIEPDDDFDIYRGV-QKVLMPMFWFDQYAELSSELASKAKLAINLSSYGIIF 454

  Fly   453 GIGLVLLGMSIVVTGIFITKKHKW 476
            |..::......::|||.:|...||
  Fly   455 GYSMIAFASVFLITGITLTVTKKW 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 165/451 (37%)
crqNP_001245823.1 CD36 19..470 CDD:307331 165/452 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917555
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.