DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and Scarb1

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001192012.1 Gene:Scarb1 MGIID:893578 Length:520 Species:Mus musculus

Alignment Length:399 Identity:116/400 (29%)
Similarity:200/400 (50%) Gaps:17/400 (4%)


  Fly    14 WVF----SMGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWT 74
            ||.    ::|.|..|:|:.:....|::.:|.:...:.:.|:|..:..|...|.|.|.:|:.|...
Mouse     9 WVALGLGALGLLFAALGVVMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVV 73

  Fly    75 NPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWN-QPQVTYFGKRTWHFLPEKSNGSLDDVVIAP 138
            ||.:: ..|.||...:.|||.:.:|:.|.::.:| ...|::...|:.||.|:||:||..|.::.|
Mouse    74 NPNEV-LNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLHFQPDKSHGSESDYIVLP 137

  Fly   139 HFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLPV 203
            :...|..::........|:.:|...|...|....|..|.|:.|: ||.|..:.|:......:||:
Mouse   138 NILVLGGSILMESKPVSLKLMMTLALVTMGQRAFMNRTVGEILW-GYDDPFVHFLNTYLPDMLPI 201

  Fly   204 YDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE-CGKVNGSTGELWS 267
             ...||.|...|||.:  |.||:.||..:.|::..:..|||.:...::..| |..:||::|::|:
Mouse   202 -KGKFGLFVGMNNSNS--GVFTVFTGVQNFSRIHLVDKWNGLSKIDYWHSEQCNMINGTSGQMWA 263

  Fly   268 PYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLKNRECP 332
            |:.|.:.....|.|:|.|.:.|...|:...:||..:|:.:.:....||.:.|..|.||    .|.
Mouse   264 PFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYRFTAPDTLFANGSVYPPNEGFC----PCR 324

  Fly   333 RNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPL--SLRGQ 395
            .:|:.:.....|..|.::|||||:..|.:..|...||.|...||.:::.:.|..|||:  |::.|
Mouse   325 ESGIQNVSTCRFGAPLFLSHPHFYNADPVLSEAVLGLNPNPKEHSLFLDIHPVTGIPMNCSVKMQ 389

  Fly   396 LMISTKVVR 404
            |.:..|.|:
Mouse   390 LSLYIKSVK 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 113/389 (29%)
Scarb1NP_001192012.1 CD36 26..447 CDD:279474 110/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.876977 Normalized mean entropy S6407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.603 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.