DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scarb2a

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_775366.1 Gene:scarb2a ZFINID:ZDB-GENE-020419-29 Length:531 Species:Danio rerio

Alignment Length:464 Identity:121/465 (26%)
Similarity:212/465 (46%) Gaps:22/465 (5%)


  Fly    21 LILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWTNPGDLNTEGVK 85
            |||.|.:.||..:..:.::.|:..:.||.||.:.:.|:..|.|||...|.||.|||.:......|
Zfish    19 LILGIALLLAQVFQTMIQERIKKEITLAENSRVLDGWINPPPPVYMQYFFFNVTNPDEFLAGKEK 83

  Fly    86 PHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHFLPEKSNGSLD-DVVIAPHFPTLTAAL 147
            ....|:||||:.:::.:|::.:  |..::.....:::.||...|.|..: |.|...:.|.:....
Zfish    84 AKVTQMGPYTYREYRPRENVTYLENGTKIFATNPKSFVFLRNMSAGDPEVDRVTTVNIPMIAVMN 148

  Fly   148 YSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLPVYDNTFGWFY 212
            ........:|..::..:...|....|..|..:.|: |:.|.||   .:||: :.|..|..||..|
Zfish   149 ELNSYSFFVRTAVSMYMGSMGMGLFMNRTVHEILW-GFKDPLL---TKLHA-MRPEVDEHFGLMY 208

  Fly   213 ERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFY-PGECGKVNGSTGELWSPYRTWDQPT 276
            .:|.  |.||.|..|||..:....|.:..|||.:...:: ..:...:||:.|.::..:.:..:..
Zfish   209 NKNG--THEGEFVFHTGEKNYMNYGKIDTWNGISQMNWWSSNQSNMINGTDGSVFHTFLSRKELL 271

  Fly   277 TIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLKNRECPRNGVLDYGP 341
            .||..|..|.::|....::.:.||..:|:...:..:.....:|....||:...:|...|||....
Zfish   272 YIFAADLCRSIHLGYVRDMEVKGIPAFRFAPPSDVLAPPDENPANAGFCVPAGDCLGKGVLKVSV 336

  Fly   342 PAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPLSL--RGQLMISTKVVR 404
            .....|..:|.|||:..|:.|.....|:.|.|.||..|:.:.||.|:|:..  |.||.|..|.||
Zfish   337 CRQGAPIVVSFPHFYQADERYINAIEGMNPNEEEHETYLDINPTTGVPIRACKRAQLNIILKRVR 401

  Fly   405 DEAIDLFKNVAY--DHYAPLFTMRLHAEL-DEGLTKLLKLALNAAIIGMYTGIGLVLLGMSIVVT 466
            .     |.|..:  :...|:..:...|.: ||...::..|.|...::..:..| ::.||:.::|.
Zfish   402 G-----FPNTKFLNETIFPIMYVNETATIDDESAAQMRMLLLIVTVVSNFPVI-ILALGVILLVV 460

  Fly   467 GIFITKKHK 475
            .||:..:::
Zfish   461 LIFLVCRNR 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 120/457 (26%)
scarb2aNP_775366.1 CD36 30..463 CDD:279474 114/446 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.