DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scav-6

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_492081.1 Gene:scav-6 WormBaseID:WBGene00008542 Length:590 Species:Caenorhabditis elegans

Alignment Length:602 Identity:126/603 (21%)
Similarity:223/603 (37%) Gaps:153/603 (25%)


  Fly     8 VRQQKIWVFSMGGLILAI-----GIFLASAWPAVSRQWIRSLLPLAPN---SFIYNRWVTTPTPV 64
            :|..|:.||.   :::||     ||...:|:.::....:...|.|..|   |..|:.:..|...|
 Worm     5 IRINKLDVFL---VVIAIVFIVFGIVTWAAFSSIYSTLVIKNLQLTENSDTSLGYSAFQYTSPQV 66

  Fly    65 YSTV--FLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWNQPQVTYFGKRTWHFLPEKS 127
            .:.:  :.||.|||.::......|:..::||::..:.:.|:.||::..:...|.:....::..| 
 Worm    67 DNIMKFYFFNVTNPDEVKYYSAAPNLVEIGPFSVMESEQKKYLEFSDDKSQMFYQNYKKYILSK- 130

  Fly   128 NGSLDDV-----VIAPHFPTLTAALY----SRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFD 183
            :.|.:|.     ::.|:.|.|.|...    ..::.:..|.::...|...|....::|...:.|||
 Worm   131 DYSCEDCDWDRNIVFPNPPGLGAVASMLDPQFQITKTGRTIIAVALTILGEYPFVSHKVREVLFD 195

  Fly   184 GYYDHLLD-----FVEQLHS--------------PLLPVYDNTFGWFYERNNSKTAEGNFTLHTG 229
            ||.|.||.     ||..|..              |.:|    .||:|...|||:..|  :.:.||
 Worm   196 GYEDALLSAAHSGFVTVLSGIFKGDGGSIVPIPIPAMP----KFGYFQGYNNSRDEE--YWIETG 254

  Fly   230 RGDLSQLGDLLLWNGENTTGFYPGECGKVNGSTGELWSPYRTWDQPTTIFLPDAARYLNLFPKEN 294
            :.|::|:|::..|.|             :....||.|    |..:..:|...|:..:..:...|:
 Worm   255 KKDINQIGNVQRWAG-------------ITELPGEWW----TTPKARSIRGSDSGSFTQMHLDES 302

  Fly   295 LTID------------------------------GIDVWRYESTN------LTIDNGQLSPDTEC 323
            .|.|                              |.|.|...|.|      ..|:.....||.. 
 Worm   303 STADMFFSFMCRSFTKTFYQRETIESIPTIGYHIGYDEWDTTSDNNVGFRYRNIEKRNYFPDWP- 366

  Fly   324 FCLKNRECPRNGVLDYGP-----------PAFNGPFYM-----------------------SHPH 354
            .|....:|.::|.:|...           ..:||.:.:                       |.||
 Worm   367 KCPPKGQCHQSGSIDCSKSINFCHACCDGSLYNGTYLLPPGMFPLVCYPGRLQPTPFAVVYSPPH 431

  Fly   355 FFLTDQMYRENTTGLQPEESEH-GMYVIMEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVA--- 415
            |..:....|....|:.|.:|.| .|....||..|..|.:..:|.::..|:|...:...:|:.   
 Worm   432 FLFSPDEVRTTVVGMAPNKSLHEPMIYYHEPYSGTTLKVVNRLQVNMPVIRSHDVPSSQNMPNVM 496

  Fly   416 ----YDHYAPLFTMRLHAELDEGLTKLLKLALNAAIIGMYTGIGLVLLGMSIVVTGIFITKKHKW 476
                :...:|.:...:..|:..|...:.:|......:.:  ||||:|  ::|:|   |:..:...
 Worm   497 IPLFWQDTSPKYHQFIFNEVWLGFVLVPRLMRVLQFVAL--GIGLLL--VAIIV---FLQLRKGK 554

  Fly   477 HSEQRPDK--HLQCTQN 491
            .|..||.|  .|:.|.|
 Worm   555 PSLIRPLKTSFLETTSN 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 114/564 (20%)
scav-6NP_492081.1 CD36 18..547 CDD:279474 114/561 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.