DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scav-5

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_509651.2 Gene:scav-5 WormBaseID:WBGene00011076 Length:536 Species:Caenorhabditis elegans

Alignment Length:558 Identity:123/559 (22%)
Similarity:214/559 (38%) Gaps:119/559 (21%)


  Fly     7 SVRQQKIWVFSMGGLILAIGIFLASA-WPAVSRQWIRSLLPLAPN--------SFIYNRWVTTPT 62
            |:::.:|..|.:.......|:.:..| ||..:.: :||...|..|        :|:|      ..
 Worm     3 SIKRYEIISFVIAAFFFLSGLSMWIAFWPIFNSE-LRSNYKLGANDDGSLHYAAFLY------AN 60

  Fly    63 PVYSTVF---LFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHF 122
            |....|.   |||.|||.::...|.||...::|.|.|.:.:.|:..|:  ::.::.|...:.:|:
 Worm    61 PPMKNVMKFNLFNVTNPDEVKYLGAKPELIEVGGYAFLESEQKKYYEFSSDKTKMFYQNYKQYHY 125

  Fly   123 --LPEKSNGSLDDVVIAPH-----------------FPTLTAALYSRRLRRILRKVMNFTLNREG 168
              :...:..:.:|.::.|:                 .||          .:||   ::..|...|
 Worm   126 SEVDNDAGYNYNDKIMFPNSIAEGAVSTVFGPQSEFSPT----------AKIL---VSIGLVMLG 177

  Fly   169 GATHMTHTAGQWLFDGYYDHLLDFVEQLHS----PLLPVYD-----------NTFGWFYERNNSK 218
            ....::.|....|.|||.|.||...   ||    .|:..|.           .||.:....||| 
 Worm   178 EYPFISKTVKDVLMDGYEDPLLSVA---HSGIFISLVNFYGYGSQLNYIPEMKTFAYLSGYNNS- 238

  Fly   219 TAEGNFTLHTGRGDLSQLGDLLLWNG--ENTTGFYPG-ECGKVNG-STGELWSPYRTWDQPTTIF 279
             .:.|:.::||..|.::||.:..|.|  :....|:|. |..::.| .:|.|...:.|.......|
 Worm   239 -YDENYWINTGYNDFNKLGFVESWAGLEQLPASFWPTLEARQIKGPDSGSLSKIHLTKTDELPFF 302

  Fly   280 LPDAARYLNLFPKENLTIDGIDVWR----YESTNLTI-----------DNGQLSPDTECFCLKN- 328
            |....|.......::..:|||....    ||..:.|:           :|....||   :|.|| 
 Worm   303 LSFMCRSFKRTYWQDGLVDGIKTMAFAVPYEEFDTTLEKNAGFRYKNQENVDYFPD---WCDKNT 364

  Fly   329 ----RECPR--NGVLDYGP--------PAFNG--PF--YMSHPHFFLTDQMYRENTTGLQPEESE 375
                .:|.:  ||.....|        |..|.  ||  .:|.|||..:....:.:.:|:.|:..:
 Worm   365 TTSLSQCQKTANGTFLLPPGIFPLVCYPGHNAQPPFTVLVSPPHFLYSPPEVQHHLSGMNPDPEK 429

  Fly   376 HGMYVI-MEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGL--TK 437
            |...|. .|.|.|..|.:..:..::..||.::. .:..:...:...|||....||.:.:.:  |.
 Worm   430 HKPMVFHQEKTSGTALQVDVRFQVNLPVVNNKG-SIMSSQMPNVIIPLFYEDSHALVKDFVMDTV 493

  Fly   438 LLKLALNAAIIGMYTGIGLVLLGMSIVVTGIFITKKHK 475
            .|.:.:...|| .|....|:.:.:.|:.|.:.|..:.|
 Worm   494 WLGVIIVPRII-EYLKFVLIFISICILTTLLVIRVRVK 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 118/537 (22%)
scav-5NP_509651.2 CD36 15..524 CDD:279474 118/539 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.876977 Normalized mean entropy S6407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.