DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scav-1

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_508919.2 Gene:scav-1 WormBaseID:WBGene00015389 Length:563 Species:Caenorhabditis elegans

Alignment Length:574 Identity:112/575 (19%)
Similarity:201/575 (35%) Gaps:140/575 (24%)


  Fly    15 VFSMGGLILAIG-IFLASAWPAVSRQWIRSLLPLAPN----------SFIYNRWVTTPTPVYSTV 68
            :|.:|..:|..| :.:.:.:|.:....|.....|..|          |::.:::::|     ...
 Worm    15 IFLIGAALLVAGLVIVLNVFPNIVNNQINDSKVLGLNADGTLNSFTDSWVNSKYIST-----MQY 74

  Fly    69 FLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEW--NQPQVTYFGKRTWHFLPEKSNGSL 131
            :::::||...:....:.|...:.|||.|.:....:.|.:  |...:.:...:|:.|.|.||....
 Worm    75 WVYDYTNTIGIMNRAIYPDVREKGPYAFDEILTMDKLNFSENGEFMEFRQIQTFVFNPNKSCAGC 139

  Fly   132 D---DVVIAP---------HFPTLTAALYSRRL-RRILRKVM------NFTLNREGG-------- 169
            |   |.|:.|         ...|:...:....| ..|...:|      |.|.:..|.        
 Worm   140 DPYKDKVLIPDMGFQVGIDQIDTVIEGILKNPLAATICHAIMKGKPNANQTCSNLGALIEGELGT 204

  Fly   170 -------ATHMTHTAGQWLFDGYYDHLLDFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGN---- 223
                   :...|.|..|.||.||   ...|||:.....|.:....||...:..:....:.|    
 Worm   205 LISLFNVSPFTTVTVDQLLFSGY---KTPFVEKFLDEALGMLHFLFGTAPKPLDDPPIQLNPLNG 266

  Fly   224 -----FTLHTGRGD------------------LSQLGDLL---LWNGENTTGFY---PGECGKVN 259
                 .|:.||:.|                  .:.:|:.|   .|...|.|  |   |.....:.
 Worm   267 TSDIINTVLTGKTDPLKAGYMTEFRSISNNSLFNSIGNTLPPMWWPYANKT--YCKDPNSALVLT 329

  Fly   260 GSTGELWSPYRTWDQPTTI---FLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDT 321
            |:.|:.   ::.:.:.|.|   |:.|..|.::......:|:.|...:|:.......|   .|.|.
 Worm   330 GTNGDY---FKNFVKKTDILPAFVSDVCRTIHFVFDREVTVKGFKGYRFVMPPTQFD---YSLDE 388

  Fly   322 EC-FCL----------KNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESE 375
            .| :|:          ....|..:|:||.. ....||..||.|||:...::..:.....:|....
 Worm   389 NCGYCIPLKYGSYEYPAQSACLPSGLLDIS-QCTGGPIIMSKPHFYQASKVVSKFVPRFKPTYDN 452

  Fly   376 HGMYVIMEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNV---------AYDHYAPLFTMRLHAEL 431
            ....:.:||..|..|..:.:|.|:.      .::.||::         ||    ||..:.....:
 Worm   453 DETMLDIEPNTGTVLQAQKRLQINM------LVNQFKHIRSYSVMRPGAY----PLAWVNESFYM 507

  Fly   432 DEGLTKLLKLALNAAIIGMYT------GIGLVLLGMSIVVTGI----FITKKHK 475
            |:.....|...|...:..:.|      |:|..|:.:|||:..:    |..:.||
 Worm   508 DQNTIDQLNSQLFTPVSTVNTICWIAVGLGAGLIALSIVMVIVSFCCFRDEHHK 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 107/561 (19%)
scav-1NP_508919.2 CD36 19..546 CDD:279474 107/554 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.635 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.