DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and Scarb2

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_446453.1 Gene:Scarb2 RGDID:621882 Length:478 Species:Rattus norvegicus

Alignment Length:480 Identity:115/481 (24%)
Similarity:212/481 (44%) Gaps:45/481 (9%)


  Fly     5 CCSVRQQKIWVFSMGG------LILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTP 63
            ||         |...|      |:.::.:.:|..:.....|.|...:.|...:.:::.|...|.|
  Rat     4 CC---------FYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLP 59

  Fly    64 VYSTVFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWNQPQVTYFGKRTWHFLPEKSN 128
            ||...:.||.|||.:: .:|..|..|::||||:.:.:.|.::::.:...|........::.|::.
  Rat    60 VYIQFYFFNVTNPEEI-LQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQ 123

  Fly   129 GSLD---DVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLL 190
            ...|   |::...:.|.||....::  :..||:::...|........:|||..:.|: ||.|.:|
  Rat   124 SVGDPTVDLIRTINIPLLTVVEMAQ--QPFLREIIEAMLKAYQQTLFVTHTVHELLW-GYKDEVL 185

  Fly   191 DFVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE- 254
            ..|......:.|    .||.|||||.  |.:|.:...||..:......::.|||:.:..::..: 
  Rat   186 SLVHIFRPDVSP----NFGLFYERNG--TNDGEYVFLTGEDNYLNFTKIVEWNGKTSLDWWTTDT 244

  Fly   255 CGKVNGSTGELWSPYRTWDQPTTIFLPDAAR--YLNLFPKENLTIDGIDVWRYESTNLTIDNGQL 317
            |..:||:.|:.:.|..:.|:...||..|..|  |:.....||  ::|:..:||:.....:.|   
  Rat   245 CNMINGTDGDSFHPLISKDETLYIFPSDFCRSVYITFSSFEN--VEGLPAFRYKVPAEILAN--- 304

  Fly   318 SPDTECFCLKNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIM 382
            |.:...||:....|...|||:........|..||.|||:..|:.:.....|::|.:.||..:|.:
  Rat   305 SSENAGFCIPEGNCMDAGVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDI 369

  Fly   383 EPTLGIPLSLRGQLMISTKVVR-DEAIDL--FKNVAYDHYAPLFTMRLHAELDEGLTKLLKLALN 444
            .|..||.|....:..|:|.|.: |:.::.  .:.:.:    |:..:.....:|:.....||..:|
  Rat   370 NPLTGIILRGAKRFQINTYVKKLDDFVETGNIRTMVF----PVMYLNESVLIDKETASQLKSVIN 430

  Fly   445 AAIIGMYTGIGLVLLGMSIVVTGIF 469
            ..:|  .|.|..:::.:.:....||
  Rat   431 TTLI--VTNIPYIIMALGVFFGLIF 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 110/457 (24%)
Scarb2NP_446453.1 CD36 28..455 CDD:279474 109/448 (24%)
Important for interaction with GBA. {ECO:0000250} 155..191 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.