DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and cd36l

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_002933143.2 Gene:cd36l XenbaseID:XB-GENE-5870091 Length:483 Species:Xenopus tropicalis

Alignment Length:502 Identity:125/503 (25%)
Similarity:220/503 (44%) Gaps:44/503 (9%)


  Fly     4 GC-CSVRQQKIWVFS---MGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPV 64
            || ||.|..|.|:.:   :|||...:||.|......::.:.:.....:...:..::.||...:||
 Frog     2 GCKCSCRCSKSWLIAGTVIGGLFAVVGIVLFPVNNILNHEAVTKTSVIEEGTAAFDNWVLPRSPV 66

  Fly    65 YSTVFLFNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWNQPQ---VTYFGKRTWHFLPEK 126
            |.:.::::..||.|: ..|.||..:|.||||:...::.: |...|.:   ::|.......|....
 Frog    67 YRSFWIYHVRNPNDI-INGGKPELQQKGPYTYLVRRIPK-LGITQHENFTMSYLQYNDAIFQRHM 129

  Fly   127 SNGSLDDVVIAPHFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLD 191
            |.||.:|.    |.....|...:..:.....:::|..:.....:.....|..:.|: ||.|   .
 Frog   130 SVGSEEDT----HTVLNVAVASTPDMFPDYHEILNTAITNSSSSLFQVRTVKELLW-GYND---P 186

  Fly   192 FVEQLHSPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE-C 255
            |:||:.   .|..|.|.|.||..|.  |.:|.:.::.|:.|:|::..:..:.||.:..::.|: |
 Frog   187 FLEQIP---FPDIDTTTGVFYPYNG--TLDGPYNVYNGKDDISKVAVIERYKGERSLSYWNGDNC 246

  Fly   256 GKVNGSTGELWSPYRTWDQPTTIFLPDAARYL-NLFPKENLTIDGIDVWRYESTNLTIDNGQLSP 319
            ..:||:...|:||:.........|.|||.|.| .:|.|| ..:.||.:.|:........:...:.
 Frog   247 NMINGTDAFLFSPFNKKKNHLFFFSPDACRSLYGVFEKE-YDLKGIKMNRFVVPKEVFASSAENS 310

  Fly   320 DTECFC--LK-NRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVI 381
            |..|||  :| .|.|..:|:|:........|.::|.|||....|...:...||:|.|.||..|:.
 Frog   311 DNHCFCKDMKVTRNCTADGILELRACRDRKPIFLSLPHFLHGSQFLLDAVGGLKPNEYEHRSYID 375

  Fly   382 MEPTLGIPLSLRGQLMISTKVVRDEAIDLFKNVAYDHYAPLFTMRLHAELDEGLTKLLK-LALN- 444
            :||..|..|....:|.|:....:...||:...:......|:..:...:.:.:...|..| :.:| 
 Frog   376 VEPVTGNALHYAKRLQINVMFQQTNKIDVMSKLQSGFVFPVLWLNETSLITDDAAKDFKAIVINP 440

  Fly   445 ------AAIIGMYTGIGLVLL---GMSIVVTGIFITKKHKWHSEQRP 482
                  .||  .:..:|.::.   .:::.|.|   :||.|..:|.:|
 Frog   441 MRTIEIVAI--QFVCVGCIMFLACSIALCVKG---SKKEKGKAEGKP 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 111/467 (24%)
cd36lXP_002933143.2 CD36 21..464 CDD:279474 111/461 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.