DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31741 and scarb1

Sequence 1:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_002935333.1 Gene:scarb1 XenbaseID:XB-GENE-494666 Length:505 Species:Xenopus tropicalis

Alignment Length:507 Identity:146/508 (29%)
Similarity:239/508 (47%) Gaps:59/508 (12%)


  Fly     8 VRQQKIWVFS-MGGLILAIGIFLASAWPAVSRQWIRSLLPLAPNS-FIYNRWVTTPTPVYSTVFL 70
            |..:|..||. :|.|::.:|..|....|.:..:.:...:.:.|:| |.|..|...|.|.|.::::
 Frog     4 VGNKKSIVFGVLGVLLVGVGTLLVFLVPVIMDEQVEKNVRIDPSSGFAYEMWRDLPVPFYMSIYI 68

  Fly    71 FNWTNPGDLNTEGVKPHFEQLGPYTFSDFKVKEDLEWNQ-PQVTYFGKRTWHFLPEKSNGSLDDV 134
            |...|..:: ..|.||..::.|||.:.::|.|:::.:|: ..|::...||:||.||||||..:|.
 Frog    69 FEVVNHKEV-LLGEKPQLQERGPYVYREYKKKQNITFNENGTVSFVEFRTFHFDPEKSNGKEEDH 132

  Fly   135 VIAPHFPTLTAALYSRRLRRILRKVMN--FTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQLH 197
            ||.|:...|.:::..:.|...::.:::  |:...|....:.|.....|   ||.|..|||:....
 Frog   133 VIVPNILVLGSSVMLQDLGIAIKWIISGAFSAFNEEAFINKTVKDILW---GYEDPFLDFLNTFL 194

  Fly   198 SPLLPVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE-CGKVNGS 261
            ...|| :...||:|.:.|||.|  |.||::||..|:|::..:..|||.....|:..| ...:||:
 Frog   195 PGKLP-FKGKFGFFSDFNNSNT--GVFTVNTGMEDISRVQMVDNWNGLKKVDFWNSEQTNMINGT 256

  Fly   262 TGELWSPYRTWDQPTTIFLPDAARYLNLFPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCL 326
            .|::|.|:|...:|...:.|||.|.:.|..::.....||..:||.:.|....||...|..|.|| 
 Frog   257 AGQMWPPFRKPSEPLEFYSPDACRSMKLVYEKEEKFRGIPTFRYTAPNYLFANGSDYPPNEGFC- 320

  Fly   327 KNRECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESEHGMYVIMEPTLGIPL- 390
               .|..:||.:.....||.|.::|.|||:..|..:.|:..||.|.|..|.:::.|.|..|||: 
 Frog   321 ---PCVASGVQNVSACRFNAPLFLSFPHFYNADPGFLESVEGLHPTEELHSLFLDMHPLTGIPMN 382

  Fly   391 -SLRGQLMISTKVVRD------------------EAIDLFKNVAYDHYAPLFTMRLHAELDEGLT 436
             |::.||.:.||.|..                  |:..|...|...:|..|..|.:..|.     
 Frog   383 CSIKMQLNMLTKSVSGIMQTGQIKPVILPVLWFAESGHLDGPVYNTYYNILILMPIVLEY----- 442

  Fly   437 KLLKLALNAAIIGMYTGIGLVLLGMSIVVTGIFITKKHK----WHSEQRPDK 484
                  |...:|    ||||..:.:::|:.   ..|:.|    |:|.:..|:
 Frog   443 ------LQYVLI----GIGLCFITVALVLP---FVKQGKCFLFWNSNKNVDE 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31741NP_724088.2 CD36 21..469 CDD:279474 136/473 (29%)
scarb1XP_002935333.1 CD36 29..460 CDD:279474 132/457 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.